BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20628 (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 2.0 Y17701-1|CAA76821.1| 81|Anopheles gambiae apyrase protein. 24 3.5 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 24 3.5 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 24 3.5 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 24 3.5 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 24 3.5 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 24 3.5 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 3.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 3.5 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 3.5 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 3.5 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 3.5 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 3.5 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 3.5 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 4.6 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 24 4.6 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 24 4.6 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 24 4.6 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 8.1 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 8.1 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 8.1 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 181 AAPIAHYSAPIAHHAAPITHYAAPIAHH 208 >Y17701-1|CAA76821.1| 81|Anopheles gambiae apyrase protein. Length = 81 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 467 VTVSTRKTTYLRSSETSRRGSRCEAA 544 +T+ + R +ETS R S+C+AA Sbjct: 39 LTIIHMNDLHARFAETSERSSKCKAA 64 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 21 VLCLFSPWSQLCL 59 VLCL PW+ +CL Sbjct: 251 VLCLLVPWTCICL 263 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 24.2 bits (50), Expect = 3.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 271 TEDYVEEVYDASQYHGQDGLGAYAYGYQTPESAKVENRVR 390 T D V EV D D +G+YA+G + +N R Sbjct: 174 TSDDVVEVRDLMARFTTDVIGSYAFGLELNSFRDPQNEFR 213 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 21 VLCLFSPWSQLCL 59 VLCL PW+ +CL Sbjct: 251 VLCLLVPWTCICL 263 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 467 VTVSTRKTTYLRSSETSRRGSRCEAA 544 +T+ + R +ETS R S+C+AA Sbjct: 39 LTIIHMNDLHARFAETSERSSKCKAA 64 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 467 VTVSTRKTTYLRSSETSRRGSRCEAA 544 +T+ + R +ETS R S+C+AA Sbjct: 39 LTIIHMNDLHARFAETSERSSKCKAA 64 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 181 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 208 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 177 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 204 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 189 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 189 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 213 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 240 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 181 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 208 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H S AHH+ + AAP+++H Sbjct: 189 AAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.8 bits (49), Expect = 4.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 380 IASDPETSPARISTRTA 430 +A+ P TS AR +TRTA Sbjct: 565 VATPPSTSRARTATRTA 581 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 124 VLLCFFGLDVNLENIDAGFRRRRHNC 47 VLL G+D +L+ +++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 124 VLLCFFGLDVNLENIDAGFRRRRHNC 47 VLL G+D +L+ +++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 124 VLLCFFGLDVNLENIDAGFRRRRHNC 47 VLL G+D +L+ +++ +R+ H C Sbjct: 24 VLLSVSGVDGSLQYVESNSQRKAHYC 49 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H + AHH+ + AAP+++H Sbjct: 181 AAPIAHYAAPIAHHAAPIAHYAAPIAHH 208 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H + AHH+ + AAP+++H Sbjct: 181 AAPIAHYAAPIAHHAAPIAHYAAPIAHH 208 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 99 SSPKKHRST*TAHHSQILN*LAAPLSYH 182 ++P H + AHH+ + AAP+++H Sbjct: 181 AAPIAHYAAPIAHHAAPIAHYAAPIAHH 208 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,268 Number of Sequences: 2352 Number of extensions: 12802 Number of successful extensions: 57 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -