BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20627 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 70 2e-12 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 58 5e-09 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 58 9e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 56 2e-08 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 4e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 45 5e-05 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 45 5e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 6e-04 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 41 0.001 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 40 0.002 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 40 0.002 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 39 0.003 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 36 0.032 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 35 0.056 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 34 0.098 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 33 0.17 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.23 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.6 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 30 1.6 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 29 3.7 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 29 3.7 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.7 SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 8.5 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 74.1 bits (174), Expect = 1e-13 Identities = 32/89 (35%), Positives = 49/89 (55%) Frame = +1 Query: 241 PRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPD 420 P + +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 421 YVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 + ++ + Y +PT IQ Q PIA+SG+ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGR 555 Score = 72.1 bits (169), Expect = 4e-13 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 KTGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI A FG Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFG 614 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 69.7 bits (163), Expect = 2e-12 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +2 Query: 551 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 706 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA G +R+T Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRST 164 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +1 Query: 313 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 480 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 58.4 bits (135), Expect = 5e-09 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 4/63 (6%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHTS 691 +TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ FG Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPL 205 Query: 692 YVR 700 +R Sbjct: 206 GIR 208 Score = 48.4 bits (110), Expect = 6e-06 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +1 Query: 337 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 58.0 bits (134), Expect = 7e-09 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 256 VSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQQ 432 V QPF K+FY P + K +P E +E+R E + V G P++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 433 GVKTMGYKEPTPIQAQGWPIAMSGK 507 +K Y++PTPIQAQ P+ MSG+ Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGR 143 Score = 31.5 bits (68), Expect = 0.69 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +2 Query: 539 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADF 679 K +Y P + P I G IA+V+ PTRELA QI + F Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKF 167 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 57.6 bits (133), Expect = 9e-09 Identities = 25/74 (33%), Positives = 42/74 (56%) Frame = +1 Query: 286 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 465 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 466 PIQAQGWPIAMSGK 507 PIQ Q P+ +SG+ Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 658 +TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ+ Sbjct: 117 ETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/79 (30%), Positives = 40/79 (50%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 451 YKEPTPIQAQGWPIAMSGK 507 ++ PTPIQ Q MSG+ Sbjct: 92 FQVPTPIQMQSLSCVMSGR 110 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +1 Query: 325 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 492 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 493 AMSG 504 G Sbjct: 197 MAHG 200 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 551 YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 658 Y P + + P + G G A+V++PTRELAQQI Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HT 688 +TGSGKT AY+LP + + Q P+AL +APTRELA+QI A F HT Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHT 579 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 361 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 VSG I F E F + + + GY+ PTP+Q PI M+G+ Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/48 (43%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQI 658 + +TG+GKTL++ LP + + + + +RG P LV+APTRELA+Q+ Sbjct: 116 QARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQV 163 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 45.2 bits (102), Expect = 5e-05 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH 685 KTGSGKTLA+++P I + Q DG ALV++PTRELA Q +V G+ Sbjct: 95 KTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIGN 147 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 ++ F + G+ G+ PT IQ QG P+A+SG+ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGR 88 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 4/63 (6%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 691 +TGSGKT A++LP + + N P A+ +APTRELA QI A F H + Sbjct: 756 QTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGT 815 Query: 692 YVR 700 +R Sbjct: 816 MLR 818 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 331 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 44.4 bits (100), Expect = 9e-05 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSY 694 + ++G+GKT + + + I+ + G D ALVLAPTRELAQQIQ+V G + Sbjct: 128 QAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMH 187 Query: 695 VR 700 V+ Sbjct: 188 VK 189 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/51 (41%), Positives = 34/51 (66%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD 676 KTGSGKTLA+++P +V + + + +G ++++PTREL+ Q VA D Sbjct: 617 KTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARD 666 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 331 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 5/65 (7%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGHT 688 +TGSGKTLAY+ P +VH + R G P A ++ P RELA QI + A H Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCHH 481 Query: 689 SYVRN 703 + R+ Sbjct: 482 ARFRS 486 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/55 (40%), Positives = 30/55 (54%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 R K G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA 519 FE+ + G+ G+ +P+PIQ + P+A++G+ LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/55 (40%), Positives = 30/55 (54%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 R K G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA 519 FE+ + G+ G+ +P+PIQ + P+A++G+ LA Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/45 (51%), Positives = 28/45 (62%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 658 KTGSGKT A+ LP + + + P G A+VL PTRELA QI Sbjct: 52 KTGSGKTAAFALPILQKLCDDP-----YGIFAVVLTPTRELAFQI 91 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/55 (41%), Positives = 34/55 (61%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 + ++G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V G Sbjct: 40 QAQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALG 89 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 703 +TGSGKT A+++P + G AL+L+PTRELA Q Q+ + G + +++ Sbjct: 326 RTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELGRFTGLKS 382 Query: 704 T 706 + Sbjct: 383 S 383 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 35.9 bits (79), Expect = 0.032 Identities = 22/53 (41%), Positives = 29/53 (54%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 +TGSGKT A+ LP + + + P AL+L PTRELA QI + G Sbjct: 9 ETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALG 56 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 35.5 bits (78), Expect = 0.043 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 14/60 (23%) Frame = +2 Query: 524 KTGSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLAPTRELAQQIQ 661 +TGSGKTLA+ +P I HI Q P +G +AL++APTRELA Q++ Sbjct: 176 ETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQVK 235 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 35.1 bits (77), Expect = 0.056 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSY 694 +++TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q + +V+ G S Sbjct: 203 KSETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQMLYEVSRLLGDKSI 254 Query: 695 V 697 V Sbjct: 255 V 255 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 34.3 bits (75), Expect = 0.098 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 694 ++++G+GKT A++L + ++ P P + L+PT ELA+Q +VA G H + Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMGKHCPH 202 Query: 695 VR 700 ++ Sbjct: 203 IK 204 Score = 31.1 bits (67), Expect = 0.92 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +1 Query: 346 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 501 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +2 Query: 611 PIALVLAPTRELAQQIQQVAADFG 682 P ALVL+PTRELA QIQ+V G Sbjct: 4 PQALVLSPTRELANQIQKVVLALG 27 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 527 TGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 655 TG+GKT A++LP + + +P + LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGK 507 + V +G+ PTPIQA P+A+ GK Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGK 48 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 373 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 486 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 I FE+ + + + V GYK+PTP+Q PI + GK Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPI-VKGK 912 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 268 VGVKQIPIWASHVLPSREF 212 VGV+ I WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 319 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +2 Query: 530 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAAD 676 GSGK LAY+LP I I + +GP+ L+L + ++ V D Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCED 285 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 203 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 93 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +2 Query: 518 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 682 + K+G+GKT + + A+ ++ I + ++L PTRE+A Q++ V G Sbjct: 56 QAKSGTGKTCVFSVIALENV-----ITESNCIQIIILTPTREIAVQVKDVICAIG 105 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 227 QNMRRPDWDLFHSNLSTKTFMIHILQFSKD 316 +N RR WD FHSN+S + H+ F D Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDFDTD 795 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 331 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 423 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 278 LLKGWSETNPNLGVACSAL 222 LLKGW TN N +AC+A+ Sbjct: 150 LLKGWGATNFNHAMACAAV 168 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 8.5 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -2 Query: 269 GWSETNPNLGVACS--ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFH 99 GW T + S AL+RI + ++ C +YRR CC L +W H + Sbjct: 181 GWRVTLRVIAATTSQQALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTN 239 Query: 98 GYYSN 84 Y+S+ Sbjct: 240 TYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,634,527 Number of Sequences: 59808 Number of extensions: 464616 Number of successful extensions: 1259 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -