BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20625 (711 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ109556-1|AAZ99795.1| 911|Homo sapiens adaptor protein HOFI pr... 31 3.1 AB037716-1|BAA92533.1| 550|Homo sapiens KIAA1295 protein protein. 31 3.1 >DQ109556-1|AAZ99795.1| 911|Homo sapiens adaptor protein HOFI protein. Length = 911 Score = 31.5 bits (68), Expect = 3.1 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 372 NPRTVSKLCPTIRESIPSAEPQLPRSGSKSVSRATEQFPEPKSGPVQGQNQYGV 533 N R +SK + E P A PQ P S+ R + P PK+ P QG++Q + Sbjct: 611 NLRPISKSKTDLPEEKPDATPQNPFLKSRPQVRP-KPAPSPKTEPPQGEDQVDI 663 >AB037716-1|BAA92533.1| 550|Homo sapiens KIAA1295 protein protein. Length = 550 Score = 31.5 bits (68), Expect = 3.1 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 372 NPRTVSKLCPTIRESIPSAEPQLPRSGSKSVSRATEQFPEPKSGPVQGQNQYGV 533 N R +SK + E P A PQ P S+ R + P PK+ P QG++Q + Sbjct: 250 NLRPISKSKTDLPEEKPDATPQNPFLKSRPQVRP-KPAPSPKTEPPQGEDQVDI 302 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,489,584 Number of Sequences: 237096 Number of extensions: 2038563 Number of successful extensions: 8305 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8299 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8287202872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -