BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20624 (445 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC5E4.05c |||serine hydrolase |Schizosaccharomyces pombe|chr 3... 25 6.9 SPBC14F5.05c |sam1||S-adenosylmethionine synthetase |Schizosacch... 24 9.1 >SPCC5E4.05c |||serine hydrolase |Schizosaccharomyces pombe|chr 3|||Manual Length = 378 Score = 24.6 bits (51), Expect = 6.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 432 DQRGYQREQQCGAEPQGCGAG 370 DQRG+ ++ G + QGC G Sbjct: 51 DQRGFGHSRKGGPKKQGCTGG 71 >SPBC14F5.05c |sam1||S-adenosylmethionine synthetase |Schizosaccharomyces pombe|chr 2|||Manual Length = 382 Score = 24.2 bits (50), Expect = 9.1 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +2 Query: 149 AFKGTD--KCDRSSSYCVPILGRGYEAGGYKCECL 247 AF G D K DRS++Y + + A G CL Sbjct: 268 AFSGKDYSKVDRSAAYAARWIAKSLVAAGLARRCL 302 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,378,666 Number of Sequences: 5004 Number of extensions: 20039 Number of successful extensions: 54 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 162176800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -