BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20622 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) 139 2e-33 SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) 49 3e-06 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 49 3e-06 SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) 49 3e-06 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 49 3e-06 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 49 3e-06 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 49 3e-06 SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) 49 3e-06 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 49 3e-06 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 49 3e-06 SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 36 0.023 SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) 36 0.023 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 36 0.023 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 36 0.023 SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) 36 0.023 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 31 0.66 SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) 31 0.87 SB_47268| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) 28 6.2 SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) 28 6.2 SB_2033| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_30029| Best HMM Match : Extensin_2 (HMM E-Value=0.45) 28 6.2 SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) 28 6.2 SB_47701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 28 8.1 >SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) Length = 108 Score = 139 bits (337), Expect = 2e-33 Identities = 63/85 (74%), Positives = 73/85 (85%) Frame = -2 Query: 293 GKILLRIQANFENLRQGKAKLVIIAKNAPPLRKSEIEYYALLAKTGVHHYSGNNIELGTA 114 GK L +++ + LRQGKAKLVIIA N P LRKSEIEYYA+LAKTGVHHY+GNNIELGTA Sbjct: 15 GKFTLGLKSTLKTLRQGKAKLVIIANNTPQLRKSEIEYYAMLAKTGVHHYTGNNIELGTA 74 Query: 113 CGKYYRVCTLAITDPGDSDIITTLP 39 CGKY+RV L+ITDPGDSDII ++P Sbjct: 75 CGKYFRVSVLSITDPGDSDIIRSMP 99 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -3 Query: 334 IESINSRLALVMKSGKYCLGYKQTLKTFDKAK 239 +ESINSRLALVMKSGK+ LG K TLKT + K Sbjct: 1 MESINSRLALVMKSGKFTLGLKSTLKTLRQGK 32 >SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 14 AKRAFVHWYVGEGMEEGEFSE 34 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 34 EAREDLAALEKDYEEVGVDS 53 >SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 232 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 198 AKRAFVHWYVGEGMEEGEFSE 218 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEE 553 EAREDLAALEKDYEE Sbjct: 218 EAREDLAALEKDYEE 232 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 384 AKRAFVHWYVGEGMEEGEFSE 404 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 404 EAREDLAALEKDYEEVGVDS 423 >SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) Length = 149 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 98 AKRAFVHWYVGEGMEEGEFSE 118 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 118 EAREDLAALEKDYEEVGVDS 137 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 552 AKRAFVHWYVGEGMEEGEFSE 572 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG DS Sbjct: 572 EAREDLAALEKDYEEVGADS 591 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 337 AKRAFVHWYVGEGMEEGEFSE 357 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 357 EAREDLAALEKDYEEVGVDS 376 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 771 AKRAFVHWYVGEGMEEGEFSE 791 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 1180 AKRAFVHWYVGEGMEEGEFSE 1200 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 1200 EAREDLAALEKDYEEVGVDS 1219 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEE 553 EAREDLAALEKDYEE Sbjct: 791 EAREDLAALEKDYEE 805 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 400 AKRAFVHWYVGEGMEEGEFSE 420 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 420 EAREDLAALEKDYEEVGVDS 439 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 385 AKRAFVHWYVGEGMEEGEFSE 405 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 816 AKRAFVHWYVGEGMEEGEFSE 836 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEV ++S Sbjct: 836 EAREDLAALEKDYEEVAVES 855 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEE 553 EAREDLAALEKDYEE Sbjct: 405 EAREDLAALEKDYEE 419 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 365 AKRAFVHWYVGEGMEEGEFSE 385 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 385 EAREDLAALEKDYEEVGVDS 404 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 400 AKRAFVHWYVGEGMEEGEFSE 420 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 833 AKRAFVHWYVGEGMEEGEFSE 853 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 853 EAREDLAALEKDYEEVGVDS 872 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEE 553 EAREDLAALEKDYEE Sbjct: 420 EAREDLAALEKDYEE 434 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 985 AKRAFVHWYVGEGMEEGEFSE 1005 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 1005 EAREDLAALEKDYEEVGVDS 1024 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 325 AKRAFVHWYVGEGMEEGEFSE 345 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 345 EAREDLAALEKDYEEVGVDS 364 >SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 250 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 198 AKRAFVHWYVGEGMEEGEFSE 218 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 218 EAREDLAALEKDYEEVGVDS 237 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 313 AKRAFVHWYVGEGMEEGEFSE 333 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 333 EAREDLAALEKDYEEVGVDS 352 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +3 Query: 450 AKRAFVHWYVGEGMEEGEFSK 512 AKRAFVHWYVGEGMEEGEFS+ Sbjct: 400 AKRAFVHWYVGEGMEEGEFSE 420 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = +2 Query: 509 EAREDLAALEKDYEEVGMDS 568 EAREDLAALEKDYEEVG+DS Sbjct: 420 EAREDLAALEKDYEEVGVDS 439 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 36.3 bits (80), Expect = 0.023 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 453 KRAFVHWYVGEGMEEGEFSK 512 ++AF+HWY GEGM+E EF++ Sbjct: 391 RKAFLHWYTGEGMDEMEFTE 410 >SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) Length = 747 Score = 36.3 bits (80), Expect = 0.023 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 453 KRAFVHWYVGEGMEEGEFSK 512 ++AF+HWY GEGM+E EF++ Sbjct: 156 RKAFLHWYTGEGMDEMEFTE 175 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 36.3 bits (80), Expect = 0.023 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 453 KRAFVHWYVGEGMEEGEFSK 512 ++AF+HWY GEGM+E EF++ Sbjct: 336 RKAFLHWYTGEGMDEMEFTE 355 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 36.3 bits (80), Expect = 0.023 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 453 KRAFVHWYVGEGMEEGEFSK 512 ++AF+HWY GEGM+E EF++ Sbjct: 391 RKAFLHWYTGEGMDEMEFTE 410 >SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) Length = 271 Score = 36.3 bits (80), Expect = 0.023 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 453 KRAFVHWYVGEGMEEGEFSK 512 ++AF+HWY GEGM+E EF++ Sbjct: 218 RKAFLHWYTGEGMDEMEFTE 237 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 31.5 bits (68), Expect = 0.66 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 453 KRAFVHWYVGEGMEEGEFSK 512 +RAF+HWY EGM+ EF++ Sbjct: 210 RRAFLHWYTTEGMDPLEFTE 229 >SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 375 Score = 31.1 bits (67), Expect = 0.87 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 453 KRAFVHWYVGEGMEEGEFSK 512 +RAF+HWY EGM+ +F + Sbjct: 296 RRAFLHWYTEEGMDSQQFEE 315 >SB_47268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 4/76 (5%) Frame = +3 Query: 390 PRAQMEKKRLKTQMKEVDLEAKRAFVHWYVGEGMEEGEFSKPVRTWLPSRRITKKSAWTP 569 P+A KK L + E+K+ VHW G+EE V TW + KS P Sbjct: 518 PKAHKAKKTLDKK------ESKKETVHWSPKTGVEEKNTLPVVPTWKSPVKKPTKSTVKP 571 Query: 570 L----KARVREPKSTK 605 L K + P +TK Sbjct: 572 LPKLAKTTFKPPSTTK 587 >SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1202 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 91 AHSPSQTLVTRTLSPLC 41 AHSP+ TL+T TL+P C Sbjct: 152 AHSPATTLITVTLTPNC 168 >SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) Length = 1311 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/62 (33%), Positives = 27/62 (43%) Frame = -2 Query: 578 RLQRSPCRLLRNPSRGQPGPHGLRELSLLHTLTDVPVHESTLGL*IDLFHLSFEPLLFHL 399 RL PCRL+ PSR P R S+L L+ VP S + L + + L Sbjct: 457 RLSSVPCRLISLPSRFSSVPS--RSSSVLCRLSSVPYRLSLVTLRLSSVPSRLNSIPSRL 514 Query: 398 CS 393 CS Sbjct: 515 CS 516 >SB_2033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 995 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 620 KIFHWLSTLRLPHP-RLQRSPCRLLRNPSRGQPGPH 516 K+FH + L P RL+R +++R + G P PH Sbjct: 154 KLFHAVVVLEFPKSQRLERGQSQVIRCSAEGYPTPH 189 >SB_30029| Best HMM Match : Extensin_2 (HMM E-Value=0.45) Length = 622 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -1 Query: 498 PPPYPHRRTSARKHAWPLDRPLSFEF*AASFPFVLLDSLAFTLP 367 PP YP R +S + +P + PLS AA+ L + + T P Sbjct: 523 PPAYPTRPSSNPPNTFPAESPLSHSGAAAAAAAALAAASSMTYP 566 >SB_27977| Best HMM Match : ARID (HMM E-Value=1.6e-26) Length = 1536 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -1 Query: 498 PPPYPHRRTSARKHAWPLDRPLSFEF*AASFPFVLLDSLAFTLP 367 PP YP R +S + +P + PLS AA+ L + + T P Sbjct: 147 PPAYPTRPSSNPPNTFPAESPLSHSGAAAAAAAALAAASSMTYP 190 >SB_47701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 233 LVIIAKNAPPLRKSEIEYYALLAKTGVHH 147 L++ A N PP + SE Y+ALL H+ Sbjct: 270 LILTAPNVPPQKGSENLYFALLTYRNPHY 298 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/74 (20%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = -3 Query: 535 EGSQVLTGFENSPSSI-PSPTYQCTKARLASRSTSFI*VLSRFFSICALGFIS--IYAPK 365 + ++++ + P+ + PS C + LAS+ ++ ++IC L S ++A K Sbjct: 630 QSARIIYAGSSVPTRLRPSKQPLCNRHHLASKQEEKTHIMKCIYTICTLALASSLVFADK 689 Query: 364 MVAAKKQKKTIESI 323 K+Q++ + ++ Sbjct: 690 KEERKEQREKVGTV 703 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,805,098 Number of Sequences: 59808 Number of extensions: 428502 Number of successful extensions: 1174 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1173 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -