BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20620 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 1.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 7.7 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 682 PSFEPRHFG*RLQHVVSVPSRNGHESDSSWV 590 PS+EP + R + P G E+DSS+V Sbjct: 375 PSYEPTYDNSRREGKQLNPLNKGTEADSSFV 405 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -2 Query: 641 CCLRAIQKWARKRQQLGCSQSS*CMRIL 558 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -2 Query: 641 CCLRAIQKWARKRQQLGCSQSS*CMRIL 558 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 305 GNIVLASFELPESNIDCIP 249 GNI + + +P NI+ +P Sbjct: 151 GNIAMELWNMPRENIEPLP 169 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,694 Number of Sequences: 336 Number of extensions: 3984 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -