BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20617 (712 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.05 |trs31||TRAPP complex subunit Trs31 |Schizosaccharom... 28 1.1 SPBC16G5.17 |||transcription factor, zf-fungal binuclear cluster... 28 1.5 SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces... 27 2.0 SPCC1259.10 |pgp1||metallopeptidase Pgp1|Schizosaccharomyces pom... 26 4.6 SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 8.1 SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 25 8.1 >SPBC1718.05 |trs31||TRAPP complex subunit Trs31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 209 Score = 28.3 bits (60), Expect = 1.1 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 537 SFSTSQQYGCNNNSPAL*FFISISNTSAQIPCVCACACVYINKWQ*SVKFQCK 379 S S +Y +N+P L FIS+ Q+ C CA I + S +F CK Sbjct: 125 SKEASDEYMIVDNNPLLNKFISVPKEMNQLNC-CAYLAGIIEGFLDSAQFPCK 176 >SPBC16G5.17 |||transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 2|||Manual Length = 560 Score = 27.9 bits (59), Expect = 1.5 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -3 Query: 542 HFRLVLHNNMDVITTHQLYN-FL*VSLTLVPKYPVCVRAHVCISISGNDL*SFSVKC 375 HFR + + LY F+ VS TLVP YP V+ SI + L S S+ C Sbjct: 397 HFRYLFLKTVFWTVRKNLYQGFITVSRTLVPNYPDIVQKLGQTSIQLSRLISNSMDC 453 >SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 27.5 bits (58), Expect = 2.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 602 PGSCHQCNSQSLEMAHKLSAP 664 PG+C +CNS +EM +AP Sbjct: 20 PGNCPRCNSDFVEMVEPNTAP 40 >SPCC1259.10 |pgp1||metallopeptidase Pgp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 412 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 585 ISLHTQKKCRTHNAAFSFSTSQQYGC 508 I L+T++K H+A+FSFS + Y C Sbjct: 250 IPLNTREK--VHSASFSFSGLESYAC 273 >SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 841 Score = 25.4 bits (53), Expect = 8.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 180 AVHKKPKPTIISTKSQVHCPAPYPFSRAESQTALDANAPSA 302 + H PTI+S V P P AE + A + + PS+ Sbjct: 271 SAHYTSSPTILSRTKSVE--TPVPMEAAEEEPATEYSIPSS 309 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 25.4 bits (53), Expect = 8.1 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 45 RKTTVWYKKFF-RRLLNVSVLNSYILLKDKSL 137 RK WYKKF+ L+N + ++I +DKSL Sbjct: 928 RKKLRWYKKFYLGELINKTRHCTFIEPQDKSL 959 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,051,608 Number of Sequences: 5004 Number of extensions: 66169 Number of successful extensions: 163 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -