BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20612 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0880 + 25620487-25620852,25620950-25621041,25621316-256217... 29 2.7 11_01_0780 - 6531579-6531608,6531732-6532064,6533219-6533325,653... 28 8.2 >06_03_0880 + 25620487-25620852,25620950-25621041,25621316-25621789, 25622079-25623039 Length = 630 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +2 Query: 86 HQVGCELVHPSKQ*KKHLQV-SARIRLLYNYISRMSNI*FYYCICTRNPHVC 238 H+V +++HP ++ LQ S R +++ +SN+ F + I T+N +C Sbjct: 75 HEVAVKMLHPIRE--DQLQAFSVRFDEIFSKCQGLSNVCFLHGISTQNGRIC 124 >11_01_0780 - 6531579-6531608,6531732-6532064,6533219-6533325, 6534267-6534316,6535110-6537065,6537458-6538209 Length = 1075 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 265 ENHSRISRFAYVWITCTDTIVK 200 + HSRISRF WI C + V+ Sbjct: 884 KKHSRISRFNIRWINCVEEDVR 905 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,682,875 Number of Sequences: 37544 Number of extensions: 239817 Number of successful extensions: 486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -