BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20612 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43375-10|AAA83627.1| 520|Caenorhabditis elegans Hypothetical p... 30 1.8 Z48009-3|CAA88078.1| 331|Caenorhabditis elegans Hypothetical pr... 28 7.4 >U43375-10|AAA83627.1| 520|Caenorhabditis elegans Hypothetical protein K09C4.1a protein. Length = 520 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 558 LNMDVTTAISVVTTIFHLNTTYPIKYCVNVNLKL 457 L D TTA SV T FH + ++ +N+NL L Sbjct: 278 LQFDTTTAQSVYTIDFHKTAGFTVQEALNINLIL 311 >Z48009-3|CAA88078.1| 331|Caenorhabditis elegans Hypothetical protein AH6.4 protein. Length = 331 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = -2 Query: 531 SVVTTIFHLNTTYPIKYCVNVNLKLQNK*YN*H---VVCS*QFNNMIYYSELIKIFNFN 364 S ++ Y I+Y V K + Y+ H VVC QF M+ YS + I N Sbjct: 204 SAAVMFYNKRLEYSIRYKVRERFKKREAIYSTHTICVVCMAQFVTMLVYSSGVLILRCN 262 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,687,521 Number of Sequences: 27780 Number of extensions: 246970 Number of successful extensions: 486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -