BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20609 (473 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 30 0.83 09_06_0231 + 21733151-21734905 28 3.3 12_02_1180 + 26727171-26727239,26728782-26729642 28 4.4 09_02_0338 + 7426999-7428322,7428390-7428646 28 4.4 01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 28 4.4 05_03_0618 - 16262826-16263097,16263111-16263183 27 5.8 09_04_0269 + 16265191-16265472,16265574-16266149 27 7.7 02_05_0132 - 26109152-26109852,26109962-26110358 27 7.7 >05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 Length = 66 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 6/41 (14%) Frame = +3 Query: 237 VSAQRESGRKHSRCCTSILRKFSGR------QHCVTVDCCC 341 + +++++G+K RCC S R+ + R + C+ CCC Sbjct: 18 LDSEQQAGKKKGRCCGSSCRRSTKRGETSFIEGCIAALCCC 58 >09_06_0231 + 21733151-21734905 Length = 584 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 377 CLASPHGVGATMAAAVNCDTMLPATKFP 294 CL P GVGA CD M PAT P Sbjct: 47 CLRLPLGVGAGGCRVCACDEMDPATAAP 74 >12_02_1180 + 26727171-26727239,26728782-26729642 Length = 309 Score = 27.9 bits (59), Expect = 4.4 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -3 Query: 282 CSSGCASCRFP--AELKPSTGATNGVNRPPVP 193 C S ASC P AEL P T A+ G +P +P Sbjct: 40 CLSTSASCTNPVSAELPPITMASQGAAKPKLP 71 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = -1 Query: 221 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYYVD 81 LM C L HR P L + L A L+AI KSYY + Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443 >01_07_0358 + 43039613-43039677,43039742-43039807,43039918-43040029 Length = 80 Score = 27.9 bits (59), Expect = 4.4 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -3 Query: 288 CLCSSGCASCRFPAELKPSTGAT 220 C C +GC C++ +E++P+T T Sbjct: 14 CQCGNGCGGCKY-SEVEPTTTTT 35 >05_03_0618 - 16262826-16263097,16263111-16263183 Length = 114 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 106 RIARREQKLKEHGASSCISGKRGRRC 183 R+ARR + LK + C G R RRC Sbjct: 11 RMARRRRWLKRRRSGHCRCGLRSRRC 36 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 218 MESTDPQCHILQHRRPRLPL 159 M T P C +L++ RPRLPL Sbjct: 157 MARTGPLCLLLENPRPRLPL 176 >02_05_0132 - 26109152-26109852,26109962-26110358 Length = 365 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 285 LCSSGCASCRFPAELKPSTGATNGVNRP 202 LC G A F A ++P +GAT RP Sbjct: 210 LCDFGFAHVGFSAAVRPPSGATRAWGRP 237 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,267,530 Number of Sequences: 37544 Number of extensions: 242440 Number of successful extensions: 580 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -