BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20609 (473 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) 27 7.9 SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) 27 7.9 >SB_38160| Best HMM Match : Toxin_29 (HMM E-Value=3.7) Length = 534 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 233 AREPL-MESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAI 108 +REP S PQ H+L +R L + ++ CS CS+ I Sbjct: 57 SREPFDSRSKLPQKHLLNSKRRALAIAKILLACSPEHCSMSFI 99 >SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) Length = 303 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 428 PNKTEKVRSWSDVENG*CLASPHGVGATMAAA 333 P K +K R W D ++G C + +G T+AAA Sbjct: 167 PEKLQKARDWDDWKDGLCGVA---IGYTVAAA 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,029,158 Number of Sequences: 59808 Number of extensions: 268118 Number of successful extensions: 636 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -