BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20607 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40902| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2144| Best HMM Match : MACPF (HMM E-Value=0.007) 28 8.4 >SB_40902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = -1 Query: 556 LHKSGTHDNYSNKYNDNPKCGTAFL*FNFVPLNLRYSGNELYWPFKFLLQIN 401 LH THDNY + + L NF +N RY N +W LQ+N Sbjct: 185 LHAVTTHDNYRELVSAAHQLEDILLSCNFNGVNCRYRCN--WWTRGLTLQLN 234 >SB_2144| Best HMM Match : MACPF (HMM E-Value=0.007) Length = 434 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 423 LNFC--CRSIKYNFLNV*IILCFWNIIVIFRTQIIIAF 316 L FC C SI + + II+ N+IVIF III F Sbjct: 176 LGFCYRCLSIIIIIVTIIIIIIIVNVIVIFTIIIIIIF 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,944,436 Number of Sequences: 59808 Number of extensions: 399741 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -