BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20607 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81524-5|CAB04253.2| 283|Caenorhabditis elegans Hypothetical pr... 28 5.6 >Z81524-5|CAB04253.2| 283|Caenorhabditis elegans Hypothetical protein F32H5.5 protein. Length = 283 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/50 (30%), Positives = 29/50 (58%) Frame = -3 Query: 686 K*NNLYYKILSSAISLNFFYNLLHVSCISYIIQTFLKKTRVSTITQEWYP 537 K +++Y+I+ I +N + +V+CI+Y ++T + RV + E YP Sbjct: 31 KFKSIFYRIVQFDILMN---TVFYVNCITYKLKTIEEYHRVLLLIFESYP 77 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,787,630 Number of Sequences: 27780 Number of extensions: 344901 Number of successful extensions: 701 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -