BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20605 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 171 4e-43 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.68 SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) 31 0.90 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.7 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 3.6 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 3.6 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 3.6 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 3.6 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 6.3 SB_25441| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 6.3 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 171 bits (417), Expect = 4e-43 Identities = 84/104 (80%), Positives = 93/104 (89%), Gaps = 2/104 (1%) Frame = +1 Query: 214 QTREHLLVF-FTNQRFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 390 +T EH+ +F + FEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 391 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNKI-ESHT 519 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNKI + HT Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127 Score = 126 bits (305), Expect = 1e-29 Identities = 56/63 (88%), Positives = 58/63 (92%) Frame = +3 Query: 510 KPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQDCYTSARGSTGTLGN 689 KPHTVPCKVTGKCGS VRLIPAPRGTGIVSAPVPKKLLQMAG++DCYTS RG T TLGN Sbjct: 124 KPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTATLGN 183 Query: 690 FAK 698 FAK Sbjct: 184 FAK 186 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 164 WVPVTKLGRLVREGKIDKLESIYLFSLPIKD 256 WVPVTKLGRLV++ KI LE IYLFSLPIK+ Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKE 38 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 31.5 bits (68), Expect = 0.68 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -3 Query: 465 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 286 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 285 RAEEEI 268 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 31.5 bits (68), Expect = 0.68 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -3 Query: 465 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 286 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 285 RAEEEI 268 R ++E+ Sbjct: 577 RNQDEL 582 >SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) Length = 389 Score = 31.1 bits (67), Expect = 0.90 Identities = 17/72 (23%), Positives = 28/72 (38%) Frame = +2 Query: 362 HLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEEVTGVTRSKATHRPLQGHR 541 H + T + W+ R + +E ++L LFY S T P H Sbjct: 199 HTISTWTIRGVSRWISYLTRCFTVLYEVFHNILYGLFYSITRGEPAYHSYWTMSPYSAHA 258 Query: 542 QVWFCNSPADSC 577 Q + CN+ ++C Sbjct: 259 QSYICNTSCEAC 270 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -3 Query: 438 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 307 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 292 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 405 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 292 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 405 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 292 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 405 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 292 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 405 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 292 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 405 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 292 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 405 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 342 TAHTFQGICCHWRQQRSYW 398 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_25441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +3 Query: 543 KCGSVTVRLIPAPRGTGIVSAPVPKKLLQMAGVQDCYTSARGSTGTLG 686 +CG+ + + R ++ P+P L ++ +Q C + STGT G Sbjct: 591 RCGTHALTKTVSERVPDVLKHPLPPPLQELQELQVCDPPSTSSTGTTG 638 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 340 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 429 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,789,802 Number of Sequences: 59808 Number of extensions: 512626 Number of successful extensions: 1389 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1388 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -