BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20604 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 2.8 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.5 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 6.5 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 569 LVNVLYISSVMTKSLYVPGFSTEQTTIVLELLSSQT 462 +V + IS + + Y+P S E+ + + +L SQT Sbjct: 243 IVPCVSISYLSVLAFYLPADSGEKIALCINILLSQT 278 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 350 SFNLSQEQKYSILVDC 397 S +S+EQ+Y ++DC Sbjct: 44 SKQISEEQRYKGMIDC 59 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 350 SFNLSQEQKYSILVDC 397 S +S+EQ+Y ++DC Sbjct: 44 SKQISEEQRYKGMIDC 59 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 383 ILVDCTDFIHRSYEIPVYKNIIMTLHLSDYLAALIQLSFAPL 508 ++V CT + + +IP N + + Y +I L+F PL Sbjct: 826 LIVVCTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPL 867 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,580 Number of Sequences: 438 Number of extensions: 3933 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -