BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20602 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 41 9e-04 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 41 0.001 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 41 0.001 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 40 0.001 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 38 0.010 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) 36 0.042 SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) 36 0.042 SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) 35 0.056 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 35 0.074 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 34 0.098 SB_732| Best HMM Match : AAA (HMM E-Value=0) 34 0.098 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 34 0.13 SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) 33 0.30 SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 33 0.30 SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) 31 0.69 SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 30 2.1 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 30 2.1 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_13630| Best HMM Match : RVP (HMM E-Value=0.27) 29 2.8 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 29 3.7 SB_7372| Best HMM Match : Rad17 (HMM E-Value=2.7e-09) 29 3.7 SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) 29 4.9 SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) 29 4.9 SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) 29 4.9 SB_56551| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=0.0049) 28 6.4 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 28 6.4 SB_6155| Best HMM Match : SRP19 (HMM E-Value=0.95) 28 6.4 SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) 28 8.5 SB_9874| Best HMM Match : Sigma54_activat (HMM E-Value=0) 28 8.5 SB_50008| Best HMM Match : SRP19 (HMM E-Value=4.6) 28 8.5 SB_30681| Best HMM Match : An_peroxidase (HMM E-Value=4.3e-29) 28 8.5 SB_29451| Best HMM Match : K_tetra (HMM E-Value=1.1) 28 8.5 SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) 28 8.5 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 28 8.5 SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_3185| Best HMM Match : Sec63 (HMM E-Value=0) 28 8.5 >SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +1 Query: 256 ALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLME 405 A+L+AG PGTGKTAIA+ +AQ LG PF + GSE++S E+ KTE L + Sbjct: 171 AVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEIFSLEMSKTEALTQ 220 Score = 57.6 bits (133), Expect = 9e-09 Identities = 26/48 (54%), Positives = 38/48 (79%) Frame = +2 Query: 113 AHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMAGQ 256 AHSHI+GLGLD+ Q++ G+VGQ +AR AAGI+++MI+ K+AG+ Sbjct: 123 AHSHIRGLGLDDALEARQVSQGMVGQVTARRAAGIILEMIKEGKIAGR 170 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 41.1 bits (92), Expect = 9e-04 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = +1 Query: 262 LLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 363 +L+GPPGTGKT +A A+A E G VPF + GSE Sbjct: 85 ILSGPPGTGKTLLAKAVAGEAG--VPFLSISGSE 116 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +1 Query: 250 RAALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 420 R LLL GPPGTGKT +A +A+E G + F + G E+ S I +E + + F RA Sbjct: 701 RGGLLLYGPPGTGKTLLAGVVAKECG--LNFISIKGPELLSKYIGASEQAVRDMFTRA 756 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/34 (58%), Positives = 23/34 (67%) Frame = +1 Query: 262 LLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 363 LL GPPGTGKT +A A+A E VPF M GS+ Sbjct: 162 LLVGPPGTGKTLLAKAVATE--ADVPFLSMAGSD 193 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 420 +LLAGPPG GKT +A AIA E G + F + G E+ + + ++E + + F+RA Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPELLNMYVGESERAVRQVFQRA 72 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 39.1 bits (87), Expect = 0.003 Identities = 27/55 (49%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LMENFRRA 420 +LL GP GTGKT IA A+A E G FC + G EV S +TE L E F A Sbjct: 293 ILLYGPSGTGKTMIARAVANETGVHF-FC-INGPEVLSRYYGETEARLREIFTEA 345 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 37.9 bits (84), Expect = 0.008 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 250 RAALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LMENFRRA 420 R+ +LL GPPGTGKT +A A+A E + F + G E+ + + ++E + E F RA Sbjct: 844 RSGVLLYGPPGTGKTLMAKAVATE--CSLNFLSVKGPELINMYVGQSEQNVREVFSRA 899 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 262 LLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS-TEIKKTEVLMENFRRAI 423 LL GPPG GKT +A AIA EL ++PF + +E+ S + E + E F A+ Sbjct: 714 LLHGPPGCGKTLLAHAIAGEL--EMPFLKLAATEIVSGVSGESEEKVRELFTSAV 766 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGT 330 +L+ GPPGTGKT +A A+A E GT Sbjct: 286 VLMVGPPGTGKTMLAKAVATECGT 309 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 366 +LLAGPPG GKT +A AIA E G + F + G E+ Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPEL 53 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 35.9 bits (79), Expect = 0.032 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 363 +LL G PGTGKT +A A+A E G VPF GSE Sbjct: 167 VLLIGSPGTGKTLLAKAVAGEAG--VPFFFCSGSE 199 >SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) Length = 568 Score = 35.5 bits (78), Expect = 0.042 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +1 Query: 256 ALLLAGPPGTGKTAIALAIAQELG 327 A LL+GPPG GKT A + QELG Sbjct: 273 AALLSGPPGVGKTTTATLVCQELG 296 >SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) Length = 1495 Score = 35.5 bits (78), Expect = 0.042 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 250 RAALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGS--EVYSTEIKKTEVLMENFRR 417 R ++L GPPG+GKT +A I + + P + S + + TE++KTE E +R Sbjct: 1249 RIVIILRGPPGSGKTHVAKLIKDKEVSSGAHAPRILSLDDYFLTEVEKTEKDPETGKR 1306 >SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) Length = 230 Score = 35.1 bits (77), Expect = 0.056 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMV 354 LL GPPGTGKT+ LA+A++L F MV Sbjct: 13 LLFYGPPGTGKTSTILAVAKQLYPDKQFGSMV 44 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 35.1 bits (77), Expect = 0.056 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 366 +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 214 VLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 247 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 366 +LL GPPGTGKT A A+A T F ++GSE+ Sbjct: 121 VLLFGPPGTGKTLCARAVANR--TDACFIRVIGSEL 154 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 34.3 bits (75), Expect = 0.098 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 363 +LL GPPG GKT +A A+A T F +VGSE Sbjct: 201 VLLYGPPGCGKTMLAKAVAHH--TTAAFIRVVGSE 233 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 34.3 bits (75), Expect = 0.098 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE 393 +LL GPPGTGKT +A I L T+ P + G EV + + ++E Sbjct: 185 ILLFGPPGTGKTLMARQIGTMLNTREPKI-ISGPEVLNKFVGESE 228 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 34.3 bits (75), Expect = 0.098 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 366 ++L G PGTGKT +A A+A + T F +VGSE+ Sbjct: 417 VILYGQPGTGKTLLAKAVANQ--TSATFLRVVGSEL 450 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELG---TKVPFCPMVGSEVYSTEIKKTE 393 +L GPPGTGKT +A A+A E KV F G++ S + ++E Sbjct: 921 VLFFGPPGTGKTLVARALANECSQGDKKVSFFMRKGADCLSKWVGESE 968 >SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 262 LLAGPPGTGKTAIALAIAQELGTKV 336 LL GPPG GKT +A IAQ G V Sbjct: 384 LLCGPPGLGKTTLAHVIAQHAGYNV 408 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +1 Query: 214 DSCRYDKK*EN---GRAALLLAGPPGTGKTAIALAIAQELGTK 333 D+ RYD N + +LL GP GTGKT++A + Q+L K Sbjct: 1739 DTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPK 1781 >SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) Length = 1199 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 256 ALLLAGPPGTGKTAIALAIAQELGTKV 336 A+L+ GP G GKTA A A ELG KV Sbjct: 640 AMLVVGPRGAGKTASIYACAGELGYKV 666 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 366 LL GPPGTGKT A ++A+ G + + M G +V Sbjct: 332 LLFYGPPGTGKTMFAKSLARHSG--MDYAVMTGGDV 365 >SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +1 Query: 256 ALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 363 A+L+ GP G GKTA A A ELG K C S+ Sbjct: 30 AMLVVGPRGAGKTASIYACAGELGYKDVECDTDASQ 65 >SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) Length = 1172 Score = 31.5 bits (68), Expect = 0.69 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +1 Query: 250 RAALLLAGPPGTGKTAIALAIAQEL-GTKVPFCPMVGSEVYSTEIKKTEVLME 405 R ++++AGPPGTGK++ A+ + L GS +++ +++K V M+ Sbjct: 1097 RTSIIVAGPPGTGKSSCISALIETLTECSATKHKNTGSPMHTHKLQKAIVYMD 1149 >SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.1 bits (67), Expect = 0.91 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = +1 Query: 265 LAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTE----IKKTEVLMENFRRAI 423 + GP G+GKTA+ LA+ + L C +V +++++ E + K + L E RA+ Sbjct: 28 IGGPVGSGKTALVLALCKYLRDSCNIC-VVTNDIFTKEDWEFLVKNKALDEKRMRAV 83 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +1 Query: 244 NGRAALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRR 417 NG +LL G PG GKT + + G K+ G++V+ ++E EN RR Sbjct: 243 NGPKGILLVGAPGVGKTLLVHKATVDCGIKL--VSTNGTDVFGPHAGESE---ENLRR 295 >SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +1 Query: 244 NGRAALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRR 417 NG +LL G PG GKT + + G K+ G++V+ ++E EN RR Sbjct: 73 NGPKGILLVGAPGVGKTLLVHKATVDCGIKL--VSTNGTDVFGPHAGESE---ENLRR 125 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 211 RDSCRYDKK*ENGRAALLLAGPPGTGKTAIALAIAQELGTKVPFC 345 +DS R DK + +LL GP G+GKT +A IA+ L C Sbjct: 263 QDSIRLDK------SNILLLGPTGSGKTLLAQTIARCLDVPFAIC 301 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQE 321 +L GPPG GKT +A AIA E Sbjct: 347 VLFYGPPGCGKTLLAKAIANE 367 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 262 LLAGPPGTGKTAIALAIAQEL 324 ++ GPPGTGKT I L +A+ L Sbjct: 875 VIQGPPGTGKTYIGLKVAKVL 895 >SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI 381 +++ GP G GKTA+ +AI +E+ K + G+ + +I Sbjct: 510 VMVTGPVGCGKTALLMAILKEIPLKQGSVTLCGTVAFVDQI 550 >SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 250 RAALLLAGPPGTGKTAIALAIAQELGTK 333 R +L+ G PGTGK+ + +A LG K Sbjct: 8 RPNILITGTPGTGKSTTGVELANRLGFK 35 >SB_13630| Best HMM Match : RVP (HMM E-Value=0.27) Length = 373 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = -2 Query: 662 TAPRISFNVNDIPNFNLL---LL*RFIYSWIK 576 T + FNV ++P+FNLL + + +Y WI+ Sbjct: 339 TQQELGFNVTELPDFNLLGRNAIKQLVYQWIR 370 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTK 333 +LL GPPG GKT + + Q L ++ Sbjct: 54 VLLTGPPGIGKTTLCSKVKQALASR 78 >SB_7372| Best HMM Match : Rad17 (HMM E-Value=2.7e-09) Length = 421 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 223 RYDKK*ENGRAALLLAGPPGTGKTAIALAIAQELGTKV 336 +Y E A LLL GP G GKTA + EL ++ Sbjct: 96 KYKPTTEPSNAILLLTGPVGAGKTATIHMLQTELSFEI 133 >SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) Length = 1104 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 265 LAGPPGTGKTAIALAIAQEL 324 L GPPGTGKT L +A+ L Sbjct: 869 LEGPPGTGKTTSILCLARAL 888 >SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) Length = 420 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 250 RAALLLAGPPGTGKTAIALAIAQEL 324 R LL GPPG GK++ A+A EL Sbjct: 222 RRGYLLYGPPGCGKSSFIQALAGEL 246 >SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) Length = 786 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 265 LAGPPGTGKTAIALAIAQEL 324 + GPPG GK+ +A+ +A EL Sbjct: 132 ITGPPGFGKSCVAIHVAHEL 151 >SB_56551| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=0.0049) Length = 113 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 139 PQAFYMTVSRDPLRFSCAFHFFNFHVESSFTLLN 38 P YM R P R F+FF F + + T LN Sbjct: 4 PSKAYMQTRRFPKRHISIFNFFTFSCKQAVTFLN 37 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELG 327 +LL G PG GKT++ AIA+ G Sbjct: 1620 ILLEGSPGVGKTSLVSAIAKASG 1642 >SB_6155| Best HMM Match : SRP19 (HMM E-Value=0.95) Length = 568 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 149 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMAGQLYS 265 N VP + L AREA G+ + + +K+A +LYS Sbjct: 4 NSVPCEPREDLYNLLDAREATGLRISVPAYRKVADELYS 42 >SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) Length = 1264 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVG 357 ++L GP G GK+++ +AI E+ K F +G Sbjct: 589 VILTGPVGGGKSSLLMAILGEIPLKRGFIKAIG 621 >SB_9874| Best HMM Match : Sigma54_activat (HMM E-Value=0) Length = 314 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 214 DSCRYDKK*ENGRAALLLAGPPGTGKTAIALAI 312 D C+ K +A++L++G GTGK IA AI Sbjct: 176 DICKDTAKIALSQASVLISGESGTGKELIARAI 208 >SB_50008| Best HMM Match : SRP19 (HMM E-Value=4.6) Length = 338 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 149 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMAGQLYS 265 N VP + L + AREA G+ + + +K+ +LYS Sbjct: 113 NSVPCEPREDLYNRLDAREATGLRISVPAYRKVVDELYS 151 >SB_30681| Best HMM Match : An_peroxidase (HMM E-Value=4.3e-29) Length = 576 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 250 GHFLTSYHIYNYPCSLTCRLLTHETGCHLNRNTIFIQ 140 G F S H+ + PC L+ + T+E L+ +TIF++ Sbjct: 401 GGFCRSPHVQSMPCFLSGDMRTNENPGLLSMHTIFLR 437 >SB_29451| Best HMM Match : K_tetra (HMM E-Value=1.1) Length = 607 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 149 NGVPIQMAAGLVGQESAREAAGIVVDMIRSKKMAGQLYS 265 N VP + L + AREA G+ + + +K+ +LYS Sbjct: 4 NSVPCEPREDLYNRLDAREATGLRISVPAYRKVVDELYS 42 >SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) Length = 486 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 256 ALLLAGPPGTGKTAIALAIAQELGTKVPFCPM 351 +L ++G PGTGKTA + +++ +V CP+ Sbjct: 237 SLYISGAPGTGKTACLTMVIRDM-KEVSDCPV 267 >SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) Length = 1345 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 259 LLLAGPPGTGKTAIALAIAQEL 324 +++AGPPGTGK++ A+ + L Sbjct: 2 IIVAGPPGTGKSSCISALIETL 23 >SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 138 GWMKMVFLFKWQPVSWV 188 G++K FLF+++P SWV Sbjct: 9 GYIKAYFLFEYEPTSWV 25 >SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 663 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 265 LAGPPGTGKTAIALAIAQELGTKVP 339 + GPPGTGKT +A+ I + P Sbjct: 590 VVGPPGTGKTDVAVQIISNIYHNFP 614 >SB_3185| Best HMM Match : Sec63 (HMM E-Value=0) Length = 2590 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 244 NGRAALLLAGPPGTGKTAIA-LAIAQELGTKVPFCPMVGSEVY 369 N LLL P G GKT +A L I +E+G + + +E + Sbjct: 1126 NSDENLLLCAPTGAGKTNVALLTILREIGKHINLDGTINTEEF 1168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,644,986 Number of Sequences: 59808 Number of extensions: 409963 Number of successful extensions: 1330 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 1243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1329 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -