BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20600 (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 23 3.0 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 5.3 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 396 MVDIAILLGADKTKATEELKESLQF 470 MV ++I+LG+ KTK +L Q+ Sbjct: 90 MVLVSIILGSLKTKEWAKLNNKFQY 114 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 5.3 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +2 Query: 467 IRNEISQHFVTSGKRRNATSL---YNPMTIAELQQKFPKVPWL 586 +R+E+++ + +G+ L Y M I+E +K+P P+L Sbjct: 324 LRHEVTEIYNENGEFTYENILGMKYLDMVISETLRKYPLAPFL 366 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,836 Number of Sequences: 336 Number of extensions: 3222 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -