SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20598
         (591 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF051030-1|ABN05618.1|  118|Apis mellifera phosphoenolpyruvate c...    22   5.2  
EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.          21   6.8  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      21   6.8  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   6.8  

>EF051030-1|ABN05618.1|  118|Apis mellifera phosphoenolpyruvate
           carboxykinase protein.
          Length = 118

 Score = 21.8 bits (44), Expect = 5.2
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 366 YLTSSCPSTCGPT 328
           Y+T++ PS CG T
Sbjct: 13  YITAAFPSACGKT 25


>EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.
          Length = 686

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +2

Query: 470 MWSWILTVPSL 502
           MW+W  T+P++
Sbjct: 658 MWAWNFTIPNM 668


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +2

Query: 470 MWSWILTVPSL 502
           MW+W  T+P++
Sbjct: 658 MWAWNFTIPNM 668


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = +2

Query: 77  KGASQARLCVHRQQCVPLTLQSHRDYLDRVLASRHVA 187
           +  +QAR+ +     + + LQ  RD L  ++   HVA
Sbjct: 311 RSTAQARVRMQVVSQLEIQLQKERDRLTAMMHHLHVA 347


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,020
Number of Sequences: 438
Number of extensions: 3930
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17237673
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -