BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20593 (541 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.11 |rpl15||60S ribosomal protein L15|Schizosaccharomyces... 113 1e-26 SPAC1783.08c |rpl1502|rpl15-2|60S ribosomal protein L15b|Schizos... 113 1e-26 SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomy... 29 0.58 SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 27 2.3 SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual 25 7.2 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 25 7.2 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 25 9.5 >SPCC576.11 |rpl15||60S ribosomal protein L15|Schizosaccharomyces pombe|chr 3|||Manual Length = 201 Score = 113 bits (273), Expect = 1e-26 Identities = 52/85 (61%), Positives = 60/85 (70%) Frame = +2 Query: 254 IAKGATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXSSYWVAQDSSYKYFEVIL 433 + KG TYGKP GVN LK R+ + AEE +SYWV QD++YK+FEVIL Sbjct: 75 VPKGQTYGKPVHQGVNHLKYQRSARCTAEERVGRYCSNLRVLNSYWVNQDATYKFFEVIL 134 Query: 434 VDPSHKAIRRDPKINWIVNAVHKHR 508 VDPSHKAIRRDP+INWIVN VHKHR Sbjct: 135 VDPSHKAIRRDPRINWIVNPVHKHR 159 Score = 99.1 bits (236), Expect = 4e-22 Identities = 42/62 (67%), Positives = 53/62 (85%) Frame = +3 Query: 33 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGYV 212 MGAY+Y++EL +KK SDV FL RVR W+YRQ+ +HRA RP+RPDKARRLGY+AKQGYV Sbjct: 1 MGAYKYLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRLGYKAKQGYV 60 Query: 213 VF 218 ++ Sbjct: 61 IY 62 >SPAC1783.08c |rpl1502|rpl15-2|60S ribosomal protein L15b|Schizosaccharomyces pombe|chr 1|||Manual Length = 201 Score = 113 bits (273), Expect = 1e-26 Identities = 52/85 (61%), Positives = 60/85 (70%) Frame = +2 Query: 254 IAKGATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXSSYWVAQDSSYKYFEVIL 433 + KG TYGKP GVN LK R+ + AEE +SYWV QD++YK+FEVIL Sbjct: 75 VPKGQTYGKPVHQGVNHLKYQRSARCTAEERVGRYCSNLRVLNSYWVNQDATYKFFEVIL 134 Query: 434 VDPSHKAIRRDPKINWIVNAVHKHR 508 VDPSHKAIRRDP+INWIVN VHKHR Sbjct: 135 VDPSHKAIRRDPRINWIVNPVHKHR 159 Score = 99.1 bits (236), Expect = 4e-22 Identities = 42/62 (67%), Positives = 53/62 (85%) Frame = +3 Query: 33 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGYV 212 MGAY+Y++EL +KK SDV FL RVR W+YRQ+ +HRA RP+RPDKARRLGY+AKQGYV Sbjct: 1 MGAYKYLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRLGYKAKQGYV 60 Query: 213 VF 218 ++ Sbjct: 61 IY 62 >SPBP35G2.06c |nup131|Nup133a|nucleoporin Nup131|Schizosaccharomyces pombe|chr 2|||Manual Length = 1142 Score = 28.7 bits (61), Expect = 0.58 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 393 LHKILHTSISRLSSWTRHTRPFVAILRSTGS*MLYISI 506 L+KIL S ++ ++T H P V ++ S LYIS+ Sbjct: 47 LYKILQISAPKVGNFTIHDAPVVGLIDSILEYYLYISV 84 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 26.6 bits (56), Expect = 2.3 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 398 QDSSYKYFEVILVDPSHKAIRRDPKINWIVNAVHK 502 + S KY E P H + PK WI++ +HK Sbjct: 1182 KSESNKYQEQAYSTPLHHTLNVLPKNKWILSRMHK 1216 >SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 366 Score = 25.0 bits (52), Expect = 7.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 99 LRVRVWQYRQLTRMHRAPRPTRPD 170 L+ +W Y L R++ PR PD Sbjct: 280 LKETMWDYLNLVRVYTRPRGLEPD 303 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 355 SLRWSPCVELLLGCTRFF 408 SL+ P V LL+G TRFF Sbjct: 568 SLKVPPLVPLLIGTTRFF 585 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 343 TCWPSLRWSPCVELLLGCT 399 +C PS R P +ELLL C+ Sbjct: 595 SCGPSYRLLPKIELLLPCS 613 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,334,063 Number of Sequences: 5004 Number of extensions: 46415 Number of successful extensions: 116 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -