BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20590 (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35774| Best HMM Match : DSPc (HMM E-Value=1e-26) 29 4.2 SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) 28 7.4 SB_17147| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_35774| Best HMM Match : DSPc (HMM E-Value=1e-26) Length = 1418 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 43 KQIPNQFVNSQFCINS-F*NHINLKMADEKKGENEHINLKVLGQDNAIVQFKIKKH 207 K NQ + Q CI F NLK+AD+ G + + KV A VQ +K++ Sbjct: 201 KYYENQISSDQTCIKEWFETEENLKIADDSVGISFQLFFKVRELVEAEVQMDLKQY 256 >SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) Length = 1058 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 329 GRGRHNRGLPTADRRSVPSVXLIILRIDHLQWVKINEVYPSQALTLS 469 G G+ + GL TA ++PSV L +DHL V + E + L ++ Sbjct: 977 GDGKEHFGLKTALHANMPSVWLPYTTLDHL-LVALGEASENSTLAIA 1022 >SB_17147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 106 NLKMADEKKGENEHINLKVLGQDNAIVQFKIKKHTPLRKLMHAYCDR 246 ++K +DE+ GE E + K G+D A +K+ P + L DR Sbjct: 33 DVKASDEEAGEEEDVEAKDNGEDGASDTI-VKEKKPCKSLSDLQDDR 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,523,576 Number of Sequences: 59808 Number of extensions: 364682 Number of successful extensions: 750 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -