BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20584 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34320.1 68414.m04259 expressed protein contains Pfam domain ... 32 0.42 At5g53800.1 68418.m06685 expressed protein 31 0.74 At3g49800.1 68416.m05445 BSD domain-containing protein contains ... 29 3.0 At2g04900.1 68415.m00509 expressed protein 29 3.0 At5g24740.1 68418.m02920 expressed protein 29 3.9 At4g37650.1 68417.m05325 short-root transcription factor (SHR) 28 5.2 At1g64550.1 68414.m07317 ABC transporter family protein similar ... 28 5.2 At3g07090.1 68416.m00843 expressed protein 28 6.9 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 28 6.9 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 28 6.9 >At1g34320.1 68414.m04259 expressed protein contains Pfam domain PF05003: protein of unknown function (DUF668) Length = 657 Score = 31.9 bits (69), Expect = 0.42 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +2 Query: 299 FFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTER--VVPIVETGA 457 F H +N++A+D+ + G +P++ENVD K+T PIV +G+ Sbjct: 19 FAHVNGHHLNNNASDLNSHSGESGLKDDPSPVTENVDDNKHTSESFSFPIVSSGS 73 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 31.1 bits (67), Expect = 0.74 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +3 Query: 516 DSGAEDISSSGSDCSTGTRGEERTDHALRTR*SDRKRQRDPTRKRSFCLSDN 671 DSG+E SGS+ R R D R SDRK R R+R + S + Sbjct: 59 DSGSESGLESGSESEKEERRRSRKDRGKRK--SDRKSSRSRRRRRDYSSSSS 108 >At3g49800.1 68416.m05445 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 428 Score = 29.1 bits (62), Expect = 3.0 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 3/79 (3%) Frame = +2 Query: 278 HDVFASQFFHTYSLP-VNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETG 454 H +F+ T S P V S A ++ EL T + E+ D+ ++E V P+ + Sbjct: 244 HPIFSKHDALTLSTPQVLESRALLSHELLRKRNKD-TVVVPESSDRGADSENVEPLFQPT 302 Query: 455 APYKKDEP--VEKTTVETL 505 P K EP V+ TVET+ Sbjct: 303 NPSPKSEPEPVKTITVETI 321 >At2g04900.1 68415.m00509 expressed protein Length = 128 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = -3 Query: 432 TRSVFFVLSTFSLIGAVTTRYPSEVSSAVTSAALEFTG 319 T S++ ++ T +L+ A +T+YP+ +T+ + F+G Sbjct: 58 TASLYHLVHTAALVSAPSTKYPNIFGGLLTAGIVAFSG 95 >At5g24740.1 68418.m02920 expressed protein Length = 3306 Score = 28.7 bits (61), Expect = 3.9 Identities = 29/83 (34%), Positives = 41/83 (49%), Gaps = 7/83 (8%) Frame = -2 Query: 652 LRFRVGSRCLFLSLHRVRRAWSVLSSPRVPVLQS-----LPLELMSSAPES*KVQGFYCR 488 ++FR+ L LHR+R+A L S PVLQ+ EL ++ P S VQ F Sbjct: 1266 IKFRIFVNLLTSKLHRLRKAPGTLLSE--PVLQADMKFVCSGELKNNFPMSLDVQFFKIG 1323 Query: 487 LFYRL--VLLVRSASLDNRYNAL 425 L+ L V+L R + D +AL Sbjct: 1324 LYSLLSSVMLARCINADGDPSAL 1346 >At4g37650.1 68417.m05325 short-root transcription factor (SHR) Length = 531 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 436 TYCRDWRSVQEGRACRKDDSRNLGLST 516 T+C W ++ E A R DD+ +L L+T Sbjct: 264 TFCTQWPTLLEALATRSDDTPHLRLTT 290 >At1g64550.1 68414.m07317 ABC transporter family protein similar to ABC transporter protein GB:AAF31030 GI:6899653 from [Leishmania major] Length = 715 Score = 28.3 bits (60), Expect = 5.2 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = +2 Query: 317 LPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIV----ETGAPYKKDEPVE 484 +P N V E+ D + ++ ++++TK E + I+ ET P KD Sbjct: 228 IPTNCQILHVEQEVVGDKTTALQCVLNTDIERTKLLEEEIQILAKQRETEEPTAKDGMPT 287 Query: 485 KTTVE 499 K TVE Sbjct: 288 KDTVE 292 >At3g07090.1 68416.m00843 expressed protein Length = 265 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 365 DGYLVVTAPISENVDKTKNTERVVPIVETGAPYK--KDEPV 481 DG +V AP E + + TE+V P+++ A + KD+P+ Sbjct: 177 DGPQIVIAPKLEAAETSTATEKVPPVIQPSASKEKVKDDPL 217 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 384 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 298 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 384 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 298 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,324,247 Number of Sequences: 28952 Number of extensions: 202626 Number of successful extensions: 635 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -