BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20582 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 28 0.099 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.8 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 3.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 4.9 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 27.9 bits (59), Expect = 0.099 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 626 ASSQQCCWK*LVYVVHSAWRIHVCILTHGHSLSWG 522 A++ CW + Y+V AW I ++ L WG Sbjct: 65 AAAVMSCWMNVYYIVILAWAIFYFFMSMRSELPWG 99 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 2.8 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = -3 Query: 608 CWK*LVYVVHSAWRIHVCILTHGHSLSW 525 CW + Y++ AW + +++ L W Sbjct: 109 CWTNIYYIIILAWALFYLLVSLRIDLPW 136 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 2.8 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = -3 Query: 608 CWK*LVYVVHSAWRIHVCILTHGHSLSW 525 CW + Y++ AW + +++ L W Sbjct: 162 CWTNIYYIIILAWALFYLLVSLRIDLPW 189 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 194 QVTLKRRSSAIKKKREIFKRVNSTSRNTA 280 Q+ LK+RSS K KR+ ++S+N A Sbjct: 141 QLPLKQRSSEFCGKNIGMKRIFTSSQNIA 169 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 373 RIRGINQVSPKSVKFCNCLDC 435 + GI+ +P C+CLDC Sbjct: 312 KYEGISS-TPSQASSCSCLDC 331 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 609 LLEVIGIRCPLSLAN 565 ++E+IGI C L LAN Sbjct: 206 IVELIGIICALCLAN 220 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,955 Number of Sequences: 438 Number of extensions: 3588 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -