BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20581 (676 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0C9K2 Cluster: Chromosome undetermined scaffold_16, wh... 36 1.2 UniRef50_UPI0000499E1E Cluster: hypothetical protein 23.t00019; ... 35 2.1 UniRef50_Q2JSW3 Cluster: Ferric iron uptake ABC transporter (FeT... 33 4.8 UniRef50_Q9UPN6 Cluster: Putative RNA-binding protein 16; n=35; ... 33 8.4 >UniRef50_A0C9K2 Cluster: Chromosome undetermined scaffold_16, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_16, whole genome shotgun sequence - Paramecium tetraurelia Length = 759 Score = 35.5 bits (78), Expect = 1.2 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 6/130 (4%) Frame = -2 Query: 483 QLPQSSLKYKMEIKALHSTLNTNIFKVGSSA*IL*SNQLSSSG*WHKDSYFKCKNFQEYS 304 QL Q+S K + +I A+ + T F S+ L + S++ + + C + Sbjct: 445 QLKQTSQKEQEKITAIKIPITTQNFDNNSNTHGLSGEENSTNDTINNHQFSNCHQILQEK 504 Query: 303 HATISLVQIQNLYQYRT----N*RKPKFPPHTAFMTQN-PTPYLRESDLPL-RNPLENKS 142 I + Q Y + ++ K P QN TP L+ S L L +NP ENK Sbjct: 505 QKIIDISQSLQKQSYSVQNSNSIQQKKSPVRVVQSQQNIMTPALKSSGLSLQKNPQENKQ 564 Query: 141 SCPFSGVSTA 112 +C F +T+ Sbjct: 565 NCYFQTNTTS 574 >UniRef50_UPI0000499E1E Cluster: hypothetical protein 23.t00019; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 23.t00019 - Entamoeba histolytica HM-1:IMSS Length = 507 Score = 34.7 bits (76), Expect = 2.1 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 1/87 (1%) Frame = -3 Query: 512 LRQNNGTCSHSYPSHH*NIKWR*KHSTQH*TLIFLKLVRLRKYYDQINYLQADNGTKIHI 333 +R +N P H+ N++++ KH + H + I +KL Y D+ Y++ DN + + + Sbjct: 46 IRSHNENLLKKVPWHYNNLQFKMKHQSIHISSINIKL--FPDYLDKQLYIRYDNPSLLKL 103 Query: 332 SNARIF-KNILTRLLALFKFKTCINTE 255 ++ K + + L K+C+ E Sbjct: 104 HPQQLIEKYCMNQYLKSIPMKSCLKNE 130 >UniRef50_Q2JSW3 Cluster: Ferric iron uptake ABC transporter (FeT) family, permease protein; n=14; Bacteria|Rep: Ferric iron uptake ABC transporter (FeT) family, permease protein - Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacteriumYellowstone A-Prime) Length = 573 Score = 33.5 bits (73), Expect = 4.8 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -1 Query: 592 LRLKIENSTVP*EAFYPLN-WNTLFRGIYDRIMVPVLTV 479 +RLK+ + ++P F+PLN W L + I+VPVLTV Sbjct: 1 MRLKLLSKSLPGSGFFPLNGWALLTLTLSGLILVPVLTV 39 >UniRef50_Q9UPN6 Cluster: Putative RNA-binding protein 16; n=35; Tetrapoda|Rep: Putative RNA-binding protein 16 - Homo sapiens (Human) Length = 1271 Score = 32.7 bits (71), Expect = 8.4 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -3 Query: 263 NTERINGNRNSRHIRPL*PKIQ--PRISEKVTYHSETHSKISRPVPSVASAPLTE 105 N ++NG RH +P +Q P + EK+T +E + + S V + S P+ E Sbjct: 1210 NVPQVNGENTERHAQPPPIPVQNDPELYEKLTSSNEINKEKSDTVADIESEPVVE 1264 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,400,031 Number of Sequences: 1657284 Number of extensions: 12851528 Number of successful extensions: 35933 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 34164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35897 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52066120554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -