BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20581 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_51546| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_26666| Best HMM Match : Pkinase (HMM E-Value=3.7e-38) 28 7.9 >SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2532 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 461 NIKWR*KHSTQH*TLIFLKLVRLRKYYDQINYLQ 360 N+K R +HS + F K + LR+ YD++ YL+ Sbjct: 1876 NVKERLEHSQTNANKTFEKDISLRQLYDEVVYLR 1909 >SB_51546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 239 RNSRHIRPL*PKIQPRISEKVTYHSETHSKISRP 138 RN RH+R ++QP E++ H + S+ ++P Sbjct: 223 RNKRHLRKTREQMQPPQPEEIEIHGPSSSRPAKP 256 >SB_26666| Best HMM Match : Pkinase (HMM E-Value=3.7e-38) Length = 1215 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -3 Query: 209 PKIQPRISEKVTYHS--ETHSKISRPVPSVASAPLTEPIPL 93 P+ ++S H T + +S PVPS S+PL +P+ Sbjct: 814 PEYIDQVSSSPPQHDYMPTQASVSSPVPSPPSSPLVSAVPI 854 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,105,198 Number of Sequences: 59808 Number of extensions: 413653 Number of successful extensions: 1152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1152 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -