BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20580 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 61 1e-09 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 57 2e-08 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 55 5e-08 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 50 2e-06 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 46 4e-05 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 42 5e-04 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 41 0.001 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 39 0.003 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 39 0.003 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 38 0.008 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.010 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 37 0.018 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.024 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 36 0.042 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.042 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 35 0.056 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 35 0.056 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 35 0.073 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 34 0.097 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.097 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 34 0.13 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 33 0.17 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 33 0.17 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.17 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 33 0.22 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 33 0.30 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 32 0.52 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 32 0.52 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 30 1.6 SB_25463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 4.8 SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) 28 6.4 SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) 28 6.4 SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) 28 6.4 SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) 28 6.4 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 28 8.4 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 28 8.4 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 60.9 bits (141), Expect = 1e-09 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 LR HF +GE++ V DP T RSRGF F+ FK P+++D V+ +G +++D KK Sbjct: 124 LRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGA-----QELDGKKM 178 Query: 450 KARHGKIFVGGL 485 KIF+GGL Sbjct: 179 VTTTKKIFIGGL 190 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEV 673 +R F +FG + E + D + +GF F+TF+ V+ +L + + GK++ Sbjct: 124 LRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKM 178 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 58.0 bits (134), Expect = 7e-09 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 5/82 (6%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 TT+ E++++F +GEI+ VK DPNT RSRGF F+ FK E V++ H I + Sbjct: 126 TTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST-SHRIQGRLC 184 Query: 435 D-----PKKAKARHGKIFVGGL 485 + PK+ K+FVG L Sbjct: 185 EVRLPRPKEELNVPKKLFVGRL 206 Score = 34.7 bits (76), Expect = 0.073 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 ++ +F+ FG I E+ D + +GF F+ F+ + ++L T R + G+ +V+ Sbjct: 131 MKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLSTSHRIQ-GRLCEVRLP 189 Query: 689 TPK 697 PK Sbjct: 190 RPK 192 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 56.8 bits (131), Expect = 2e-08 Identities = 32/103 (31%), Positives = 60/103 (58%), Gaps = 12/103 (11%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESID 389 E K F TT++ L+D+F +G I + + +K D GRSRGF F+ +++ +S++ Sbjct: 47 EKLRKIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRD---GRSRGFGFVTYESSDSVN 103 Query: 390 KVMAAGEHTINNKKVDPKK-----------AKARHGKIFVGGL 485 +V+ +H +++++++PK+ A ++ KIFVGGL Sbjct: 104 EVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGL 146 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/63 (33%), Positives = 39/63 (61%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 ++++FS++GTI V+ K + +GF F+T+ES VN++LK +E++ KR+ Sbjct: 66 LKDYFSQWGTI--VDCVIMKRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRS 123 Query: 689 TPK 697 P+ Sbjct: 124 VPR 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 7/73 (9%) Frame = +3 Query: 255 TTDKELRDHFGAY------GEIESINVKTD-PNTGRSRGFAFIVFKAPESIDKVMAAGEH 413 T +++++++F + GE+ +++K D N R RGFAF+ F E ++KV A H Sbjct: 150 TVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYH 209 Query: 414 TINNKKVDPKKAK 452 I K+ + KKA+ Sbjct: 210 EIRMKQCEVKKAE 222 Score = 34.7 bits (76), Expect = 0.073 Identities = 15/56 (26%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +2 Query: 533 GTILEVEMPFDKTKNQR-KGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 G +++V++ D+ +R +GF F+TF+++ +V + K+ +VK+A P+ Sbjct: 169 GEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 224 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 55.2 bits (127), Expect = 5e-08 Identities = 33/91 (36%), Positives = 44/91 (48%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 +D K F TT + L+++F YGE+ +++K D TGR RGFAF+ FK D Sbjct: 26 DDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADA 85 Query: 393 VMAAGEHTINNKKVDPKKAKARHGKIFVGGL 485 + I K R KIFVGGL Sbjct: 86 IDPKPAAPIG------KPPHLRVKKIFVGGL 110 Score = 54.4 bits (125), Expect = 8e-08 Identities = 23/66 (34%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +3 Query: 255 TTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 431 T+D+++R++FG AY ++ I T+ ++ R RGF F+ F + +++DK+ H I K Sbjct: 114 TSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNK 173 Query: 432 VDPKKA 449 V+ K+A Sbjct: 174 VEVKRA 179 Score = 54.4 bits (125), Expect = 8e-08 Identities = 24/64 (37%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSE-FGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKR 685 IR +F + + + E+E + + N+R+GFCF++F+SE V+ + +T G +V+VKR Sbjct: 119 IREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKR 178 Query: 686 ATPK 697 A PK Sbjct: 179 ALPK 182 Score = 30.3 bits (65), Expect = 1.6 Identities = 9/36 (25%), Positives = 23/36 (63%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 ++ +FS++G ++ V++ D + +GF F+ F+ + Sbjct: 45 LKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQ 80 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 50.8 bits (116), Expect = 1e-06 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 15/92 (16%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF---KAPESI--DKVMAAGEHTI 419 TT++ LR++F AYGE+ + V D T +SRGF ++ F K ++ DKV G H I Sbjct: 25 TTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV-ENGAHRI 83 Query: 420 NNKKVDPKKAKARHG----------KIFVGGL 485 + K+V+ K+A R KIFVGGL Sbjct: 84 DGKEVEVKRAIPRDDNSATSHEKTKKIFVGGL 115 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKG----GKEVD 676 +R +F +G + +V + D + +GF ++TF V ++LK GKEV+ Sbjct: 30 LREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVE 89 Query: 677 VKRATPK 697 VKRA P+ Sbjct: 90 VKRAIPR 96 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +2 Query: 563 DKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 D+TK+ +GF F+ +E ++L K GK V+ K+ATP+ Sbjct: 147 DETKH--RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 Score = 27.9 bits (59), Expect = 8.4 Identities = 32/136 (23%), Positives = 55/136 (40%), Gaps = 6/136 (4%) Frame = +3 Query: 69 FAQDITTDNQLNGNAENGGG--DSQDHNSAAAPGRDDDRCEXXXXXXXXXEDAMKTFCWW 242 FA T N L ENG D ++ A RDD+ E K F Sbjct: 62 FADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSH-------EKTKKIFVGG 114 Query: 243 AELGTTDKELRDHFGAYGE--IESINV--KTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 410 T +++++ + E ++ +++ K + T + RGFAF+ + D++ + Sbjct: 115 LPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDET-KHRGFAFVELNNEDQADELCCVKK 173 Query: 411 HTINNKKVDPKKAKAR 458 + K V+ KKA R Sbjct: 174 IHVKGKMVEAKKATPR 189 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/78 (35%), Positives = 44/78 (56%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 431 GT ++ L+D+F +GE+ES+ + G SR + F++FK + K + H IN K Sbjct: 90 GTDEEGLKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLFK-DDGPSKEVLKKSHVINGKT 147 Query: 432 VDPKKAKARHGKIFVGGL 485 VD K++ I+VGGL Sbjct: 148 VDVGKSR-NFRVIYVGGL 164 Score = 41.5 bits (93), Expect = 6e-04 Identities = 15/60 (25%), Positives = 34/60 (56%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T + ++ +F YG++ +++ TD TG+S+G + + P +++K++ H I +V Sbjct: 330 TKELDVLRYFRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVIGKSQV 389 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +3 Query: 246 ELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 425 + TT ELR++F GE+ I++ N+ + A + F+ + I KV+ HTI Sbjct: 244 DFDTTVDELREYFEKCGELTGIDLLI--NSEKRTCAAIVFFRNLKDIKKVVEE-NHTIKG 300 Query: 426 KKV 434 KV Sbjct: 301 LKV 303 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +3 Query: 324 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 458 D T R RGF F+ F++ S DK H INNKKV+ KKA+ + Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +2 Query: 560 FDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 FDK + +GF F+TFESE + T K+V+VK+A PK Sbjct: 4 FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 D+ LR+ F YG I S V D + G S+GF F+ F +PE K + Sbjct: 225 DERLREEFSPYGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/69 (28%), Positives = 40/69 (57%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 D+++++ G+I S+ V TDP G+S+GF F+ F+ PE ++ + + +N K++ Sbjct: 122 DEQMKEICAEAGKIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV----NVLNGKEIGG 176 Query: 441 KKAKARHGK 467 ++ A K Sbjct: 177 RRLWAGRAK 185 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +2 Query: 542 LEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 LE++M D+ N+ KG+CF+ F +E +V+ L GK+V++K+A Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 Score = 40.3 bits (90), Expect = 0.001 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 17/105 (16%) Frame = +3 Query: 222 MKTFCWWAELGTTDKELRDHF-----GAYGEIESINVKTDPNTGRSRGFAFIVFK-APES 383 MK F TT++ +R +F G+ ++ S+++ P G+SR F F+ F + Sbjct: 8 MKLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVSLAKTPE-GKSRKFCFVEFSNGSDI 66 Query: 384 IDKVMAAGE-HTINNKKVDPKKAKARHG----------KIFVGGL 485 ID ++ E H+I+NK+V+ K+A R K+F+GGL Sbjct: 67 IDNIVFNFESHSIDNKQVEVKRAMPRDDPNELAHVRTKKLFIGGL 111 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +3 Query: 309 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 I + D T + +G+ F+ F +DK+ + K V+ KKA Sbjct: 135 IKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--DPK 443 L FG YG IE +++ TG+S+GF ++ ++ ES + + AG H I+ K V +PK Sbjct: 79 LESVFGPYGAIEDLSI-IRTQTGKSKGFGYVTYENAESAQRAL-AGTHIIDGKWVIAEPK 136 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 345 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 458 +GF F+ F+ P +I+ V+A H ++ K +DPK A R Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR 179 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 560 FDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 F++ KGF F+TF + +L GK +D K A P+ Sbjct: 134 FERRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR 179 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIE 305 K F GTT+++L+++F YG +E Sbjct: 203 KVFIGGLAFGTTEEDLKEYFSTYGMVE 229 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/66 (28%), Positives = 39/66 (59%), Gaps = 2/66 (3%) Frame = +3 Query: 255 TTDKELRDHFGAYGE-IESIN-VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 428 T + + ++F GE +E + ++T +G+S+GFAF+ + E+++ V+ +H I+N Sbjct: 53 TVESTIFEYFSTLGEQVEHVKCIRT--LSGKSKGFAFVRLRKKEAVESVLGRDDHVIDNS 110 Query: 429 KVDPKK 446 V +K Sbjct: 111 DVSMEK 116 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEV 673 I FS G I V +P + +RKG C +TF S +++K K G ++ Sbjct: 137 ILEHFSSSGEIASVYIPENLKTKERKGHCIVTFASVTEAFEVVKKRKHHIHGYDI 191 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/54 (22%), Positives = 27/54 (50%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 422 + ++ +HF + GEI S+ + + T +G + F + +V+ +H I+ Sbjct: 134 ESQILEHFSSSGEIASVYIPENLKTKERKGHCIVTFASVTEAFEVVKKRKHHIH 187 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 39.1 bits (87), Expect = 0.003 Identities = 28/70 (40%), Positives = 34/70 (48%), Gaps = 7/70 (10%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES----EPVV---NDLLKTPKRTKGGK 667 ++ FSEFG +L V +P K + KGF FI FES E VV N KT K K Sbjct: 104 LKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFNRESKTKKEEKREP 163 Query: 668 EVDVKRATPK 697 +D K K Sbjct: 164 SIDDKTKIKK 173 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/59 (22%), Positives = 30/59 (50%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 446 L+ F +G++ +++ + G +GFAFI F++ + + V+ KK + ++ Sbjct: 104 LKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFNRESKTKKEEKRE 162 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 TT ++L+ F YG++ I + D NT SRGFAF+ F + M Sbjct: 27 TTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAM 74 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 37.9 bits (84), Expect = 0.008 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 +++ F YG ++++++ TD SRGFA++ + PE +K + Sbjct: 1173 VQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTK-GGKEVDVKR 685 ++ FS +G + V++P D+T N +GF ++ + LK + G+E+ V+ Sbjct: 1173 VQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQS 1232 Query: 686 ATP 694 P Sbjct: 1233 VLP 1235 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 303 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 E++N+ TD TGR RGF F+ F + E ++K + Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 37.5 bits (83), Expect = 0.010 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 294 GEIESINVKTDPNTGRSRGFAFIVFKAPESI 386 G +E++ + TD NTG+ R F F+ F +P S+ Sbjct: 481 GPLENVRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 389 TT+ ELR F YG ++ + D + G S+G+AFI F++ E D Sbjct: 19 TTESELRAFFEEYGVVKESKIVRDKH-GVSKGYAFITFESQEVAD 62 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDL 634 +R FF E+G + E ++ DK KG+ FITFES+ V + L Sbjct: 24 LRAFFEEYGVVKESKIVRDK-HGVSKGYAFITFESQEVADGL 64 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 36.3 bits (80), Expect = 0.024 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +3 Query: 261 DKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN 422 +K L D F A+G I ++ + D +TG S+GFAFI F + ++ D + A G++ N Sbjct: 113 EKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN 169 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T+ +L F YG++ + + D T SRG AFI+F +S +AA Sbjct: 22 TNSDLHKVFERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAVAA 70 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 35.9 bits (79), Expect = 0.032 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 6/82 (7%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK-- 428 + ++++ FG G + S + D TG+S G+AF+ + P+ +K V + NK Sbjct: 39 SQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTL 98 Query: 429 KVD---PKKAKARHGKIFVGGL 485 KV P + ++ +++ GL Sbjct: 99 KVSFARPSSTEIKNANLYISGL 120 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 35.5 bits (78), Expect = 0.042 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 TTD++L F +G I S V D TG S +AFI F+ E ++ Sbjct: 131 TTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEFEKDEDCER 176 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 FS FGTIL E+ D+ + + FI FE + Sbjct: 140 FSRFGTILSCEVIRDQKTGESLQYAFIEFEKD 171 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 35.5 bits (78), Expect = 0.042 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 +D FC ++L + F G++ + + +D N+ RS+G A+I F Sbjct: 143 KDQRTVFCMQLARNIRPRDLEEFFSKVGQVSDVRIISDRNSRRSKGIAYIEF 194 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 ++ F FGT+ V++ +D N+ KG+ F+ F Sbjct: 258 VKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQF 290 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 35.1 bits (77), Expect = 0.056 Identities = 13/58 (22%), Positives = 31/58 (53%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 ++ LR+ F G +ES+ + D TG +GF +++F++ +++ + +K+ Sbjct: 69 EEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKI 126 Score = 31.5 bits (68), Expect = 0.68 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R F+ G + V + D+ KGF ++ FES+ V LK G+++ V + Sbjct: 72 LRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPS 131 Query: 689 TPKP 700 KP Sbjct: 132 KDKP 135 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 35.1 bits (77), Expect = 0.056 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 5/69 (7%) Frame = +3 Query: 294 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK----AKAR- 458 GEI ++ DP TG ++GFAF F S + + T+N+K + P + K+R Sbjct: 177 GEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT----TLNDKDIRPGRRLAICKSRS 232 Query: 459 HGKIFVGGL 485 + ++FV G+ Sbjct: 233 NSRLFVKGI 241 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.056 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 306 SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 S+ V TD TGR RGF F+ F + + +DK + Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVD 437 + +L+D F Y ++ + V +D T R RGFAF+ F + +++ D + + + + Sbjct: 243 EADLQDRFSRY-DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMK 301 Query: 438 PKKAKAR 458 +A++R Sbjct: 302 VNQARSR 308 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 539 ILEVEMPFDKTKNQRKGFCFITFESEPVVNDLL-KTPKRTKGGKEVDVKRATPK 697 +L V++ D+ + +GF F+TF SE ++ + K G+ + V +A P+ Sbjct: 35 LLSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPR 88 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 35.1 bits (77), Expect = 0.056 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 +T K + + F +G+I V D T S+G AF+ +++ ES+ + +AA Sbjct: 427 STQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAA 476 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EPVVNDLLKTPKRTKG 661 I N F +FG I ++ D KG F+ + S E V L T + ++G Sbjct: 432 ITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAATDEDSEG 483 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 34.7 bits (76), Expect = 0.073 Identities = 22/66 (33%), Positives = 33/66 (50%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 TTD +L YG I S D +T +G+ F+ F++P S K +AA + NK + Sbjct: 111 TTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAA----LVNKGI 166 Query: 435 DPKKAK 452 + AK Sbjct: 167 QAQMAK 172 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 527 EFGTILEVEMPFDKTKNQRKGFCFITFES 613 ++GTI+ + DK N KG+ F+ FES Sbjct: 122 KYGTIISTKAILDKDTNLCKGYGFVDFES 150 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 34.3 bits (75), Expect = 0.097 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 297 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 ++ + V TD TGR RGF F+ F + E ++K + Sbjct: 29 DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 34.3 bits (75), Expect = 0.097 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 +++ F G + V +P G SRGFAF+ + E +K G+ N ++V+ Sbjct: 222 IKELFSQTGNVTFAQVAINPANGGSRGFAFVDYATAEEAEK----GQRAHNGRQVEGSNI 277 Query: 450 KARHG 464 + +G Sbjct: 278 RVAYG 282 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 T+ + D YG IE + + TG S+G+ F+ + E+ Sbjct: 125 TETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYATREN 166 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVK-- 682 +R FF++FG I E + D+ + KG+ F+T + K + G++ +V Sbjct: 26 LRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKRPMIEGRQANVNLA 85 Query: 683 --RATPKP 700 A PKP Sbjct: 86 YLGAKPKP 93 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 389 D LR F +GEI V D T +S+G+ F+ ++ + Sbjct: 23 DDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAE 65 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFE 610 F FG I +V++P D T ++ +GF F+ FE Sbjct: 25 FIPFGDITDVQIPMDYTTSKHRGFGFVEFE 54 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 380 +K L F +G+I + + D T + RGF F+ F+ E Sbjct: 18 EKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAE 57 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +3 Query: 267 ELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 386 E+ F +G +E +++ D +GRSRGF F++ ++ + I Sbjct: 24 EIEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQI 62 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/58 (27%), Positives = 24/58 (41%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 + FC TD+ L F Y + D + +S+G+ F+ FK P K M Sbjct: 218 RIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPNDFIKAM 275 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/58 (27%), Positives = 31/58 (53%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATP 694 F+++ + L+ ++ DK N+ KG+ F++F+ +P ND +K + D TP Sbjct: 237 FAKYTSFLKAKIVRDKKSNKSKGYGFVSFK-DP--NDFIKAMREMNVLSFADQHLLTP 291 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 ++ +R F +G I I++ DP + +GFAF+ + PE+ Sbjct: 115 EEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEA 155 Score = 33.1 bits (72), Expect = 0.22 Identities = 11/48 (22%), Positives = 30/48 (62%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 + +++ F A+G++ ++ +P TG+ +G+ FI ++ +S + +A+ Sbjct: 212 EDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIAS 259 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKR-TKGGKEVDVKR 685 I++ F FG ++ + + + KG+ FI +E++ ND + + GG+ + V R Sbjct: 215 IKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRVGR 274 Query: 686 ATPKP 700 A P Sbjct: 275 AITPP 279 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI---VFKAPESIDKVMAAGEHTINNKK 431 + ++ + F YGEI++++V D TG +G+A + FK +S + + E N Sbjct: 306 EDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNIS 365 Query: 432 VD 437 VD Sbjct: 366 VD 367 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKT 643 I F + G + +V++ +D + Q KGFCF+T ++ + ++T Sbjct: 291 ITALFGQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQT 335 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 + E R F AYG I + + D +TG +G F+++ Sbjct: 146 EAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLY 181 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 291 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 530 FGTILEVEMPFDKTKNQRKGFCFITFESE 616 +G I+ V + DK ++KGFCF+ +E + Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQ 30 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 291 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 530 FGTILEVEMPFDKTKNQRKGFCFITFESE 616 +G I+ V + DK ++KGFCF+ +E + Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQ 30 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 413 G + E++ F +G + I + + RS+G+AF+ F A + + K+ A H Sbjct: 108 GFFENEIKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEF-ACDEVAKIAADTMH 160 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPV 622 I+ FF +FGT+ + + K + KG+ F+ F + V Sbjct: 114 IKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEFACDEV 151 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 31.9 bits (69), Expect = 0.52 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 2/88 (2%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K +C T+K+L + +G++ ++ K G+A++VFK + D+ +AA Sbjct: 4 KVYCGRLPATATEKDLENLVKVFGKVREVDFK--------EGYAYVVFKENKDADRAVAA 55 Query: 405 -GEHTINNKKVDPKKAK-ARHGKIFVGG 482 + K+ +KAK R+G VGG Sbjct: 56 LNNSEFHGAKILMEKAKEMRNG---VGG 80 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 31.9 bits (69), Expect = 0.52 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 IR+ F ++GTI +V + DK + +G C++ F Sbjct: 39 IRSAFEQYGTIEDVWVVKDKATKENRGVCYVKF 71 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +3 Query: 264 KELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK 443 +++R F YG IE + V D T +RG ++ F S +A E N DPK Sbjct: 37 EDIRSAFEQYGTIEDVWVVKDKATKENRGVCYVKFVKASS--AALACEEMDGRNIGDDPK 94 Query: 444 KAK 452 K Sbjct: 95 PIK 97 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/70 (28%), Positives = 36/70 (51%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 T+++LRDHF +GE+ SI++ N AF+ F + + + AA + + N + Sbjct: 316 TEQDLRDHFYQFGELRSISMVPRQNC------AFVCFTSRAAAE---AAADRSFNKLILK 366 Query: 438 PKKAKARHGK 467 ++ K GK Sbjct: 367 GRRLKIMWGK 376 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 545 EVEMPFDKTKNQRKGFCFITF-ESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 EV + D KN+ KGF F++F E + + T GGK+V A K Sbjct: 541 EVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 592 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 309 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKV 434 + V DP +S+GF F+ F E K +A + TI K+V Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQV 584 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 T + +L++ F G I I + D T +S+GFAFI F Sbjct: 192 TRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINF 229 >SB_25463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 700 WF-WCCTLHIDLLSTFCSFGSLKQIIYNWLRFKCDETE 590 WF W C L I LS++ SLK +Y W + ++ E Sbjct: 126 WFPWSCFLRIRYLSSWRQLLSLKNTMYRWPQLPSNDCE 163 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 5/80 (6%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 + EL F G I + DP +G ++GFAF F + + ++NK++ P Sbjct: 165 EDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV----KKLDNKEIRP 220 Query: 441 KK-----AKARHGKIFVGGL 485 K + ++FVG + Sbjct: 221 GKRLGVCISVANSRLFVGSI 240 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAF 359 + ++++ ++GE+ + N+ D TG S+G+AF Sbjct: 686 EDQVKELLSSFGELRAFNLVKDSATGLSKGYAF 718 >SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = -3 Query: 699 GFGVARFTSTSFP---PFVLLGVLSKSFTTGSDSNVMKQKPFLWFFVLSK 559 G G+ R++S S P F G +S S+T V ++ FL FFVL K Sbjct: 388 GSGITRYSSLSVPFYCKFSSHGDVSLSYTIKKSVPVWHEEKFLSFFVLYK 437 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 57 NNDNFAQDITTDNQLNGNAE-NGGGDSQDHNS 149 NND+ D T D+ N N + NGGG D+N+ Sbjct: 193 NNDDDDDDDTDDDDHNNNDDDNGGGGDDDNNN 224 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 60 NDNFAQDITTDNQLN-GNAENGGGDSQDHNS 149 +DNF DI+ D LN G A N + ++NS Sbjct: 335 HDNFNDDISNDGNLNGGGANNNNNKNNNYNS 365 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 300 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 I+ + K+ N G++ G AF+VFK+ K + I ++ ++ Sbjct: 361 IDLLKHKSGKNQGKNTGVAFVVFKSNNDASKALKMDRSYIGHRYIE 406 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 300 IESINVKTDPNTGRSRGFAFIVFKAPES 383 + + V TD TGR RGF F+ +A ++ Sbjct: 107 VVDVRVITDRETGRPRGFGFVTLEAKKT 134 >SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 28.7 bits (61), Expect = 4.8 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 8/70 (11%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDH-----FGAYGEIESINVK---TDPNTGRSRGFAFIVF 368 +DA+ W +G DK L + +GEIE PN G RG+ F+ F Sbjct: 381 DDAVSERKLW--IGNLDKRLSEFNILKILQQFGEIEHFQFLFHGNGPNRGEPRGYCFVEF 438 Query: 369 KAPESIDKVM 398 K E K + Sbjct: 439 KKKEDARKAL 448 >SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +3 Query: 60 NDNFAQDITTDNQLNGNA-ENGGGDSQDHNSAAAPGRDDD 176 ND+ DI D+ NGN +NG + D N G DDD Sbjct: 20 NDDDGDDIDDDDG-NGNGNDNGDDNDDDDNDDEGNGDDDD 58 >SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) Length = 599 Score = 28.3 bits (60), Expect = 6.4 Identities = 9/30 (30%), Positives = 22/30 (73%) Frame = +3 Query: 60 NDNFAQDITTDNQLNGNAENGGGDSQDHNS 149 ND+ A D++ ++ + G+ +NGG D+ ++++ Sbjct: 180 NDDSASDVSIEDIIYGDDDNGGDDNDNYDN 209 >SB_45368| Best HMM Match : fn2 (HMM E-Value=3.1e-32) Length = 1206 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 66 NFAQDITT--DNQLNGNAENGGGDSQDHNSAAAPGRDDD 176 +F ++T +N NGN E+ D D +AAA DDD Sbjct: 536 SFRSSLSTVCNNCENGNEEDNDDDDDDDAAAAAAADDDD 574 >SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) Length = 691 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 57 NNDNFAQDITTDNQLNGNAENGGGDSQD 140 +++++A D DN +NG+ ++GGGD D Sbjct: 585 DDEDYAGD--GDNDVNGDGDSGGGDDDD 610 >SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) Length = 244 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 54 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAAAPGRDDD 176 A N+ +A+ +T +N N N N ++ ++N+ DDD Sbjct: 160 AINEKYAKIMTDNNNNNNNNNNNNNNNNNNNNNNNNNNDDD 200 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 ++ FSE G ++ + FD+ + KG+ F ++ + Sbjct: 41 LKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQ 76 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTD 326 GTT+ ++R F +YG + IN+K + Sbjct: 13 GTTEDDVRRFFRSYGRLRDINLKNN 37 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 57 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 149 NN+N D +DN + N++N ++ D+N+ Sbjct: 613 NNNNNNNDNNSDNNSDNNSDNNSDNNSDNNN 643 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 57 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 149 NNDN + D +DN + N++N ++ D+NS Sbjct: 618 NNDNNS-DNNSDNNSDNNSDNNSDNNNDNNS 647 >SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 57 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 146 NNDN+ + DN N N NG DS D+N Sbjct: 90 NNDNYDNNGNNDNNDNYNNYDNNGNNDSNDNN 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,344,844 Number of Sequences: 59808 Number of extensions: 412808 Number of successful extensions: 2367 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 1201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2282 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -