BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20580 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 64 1e-10 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 60 2e-09 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 58 4e-09 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 58 4e-09 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 58 7e-09 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 56 2e-08 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 56 2e-08 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 56 2e-08 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 55 5e-08 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 55 5e-08 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 55 5e-08 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 54 7e-08 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 52 4e-07 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 50 1e-06 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 50 2e-06 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 50 2e-06 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 49 3e-06 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 49 3e-06 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 48 5e-06 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 48 6e-06 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 48 6e-06 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 46 2e-05 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 46 2e-05 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 46 2e-05 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 46 3e-05 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 46 3e-05 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 45 4e-05 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 45 6e-05 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 44 7e-05 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 44 7e-05 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 44 7e-05 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 44 1e-04 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 44 1e-04 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 44 1e-04 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 44 1e-04 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 44 1e-04 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 44 1e-04 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 43 2e-04 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 42 3e-04 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 42 3e-04 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 42 3e-04 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 42 3e-04 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 42 3e-04 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 42 4e-04 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 42 5e-04 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 41 7e-04 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 41 7e-04 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 41 7e-04 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 41 7e-04 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 41 7e-04 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 41 7e-04 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 41 7e-04 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 41 0.001 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 40 0.001 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 40 0.001 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 40 0.001 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 40 0.001 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 40 0.001 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 40 0.001 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 40 0.001 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 40 0.001 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 40 0.001 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 40 0.001 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 40 0.001 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 40 0.002 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 40 0.002 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 40 0.002 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 40 0.002 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 40 0.002 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 39 0.003 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 39 0.003 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 39 0.004 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 39 0.004 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 39 0.004 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 39 0.004 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 39 0.004 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 39 0.004 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 39 0.004 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 38 0.005 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 38 0.005 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 38 0.005 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 38 0.005 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 38 0.006 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 38 0.006 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 38 0.006 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 38 0.006 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 38 0.006 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 38 0.009 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 38 0.009 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 38 0.009 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 38 0.009 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 38 0.009 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 38 0.009 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 37 0.011 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 37 0.011 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 37 0.015 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 37 0.015 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 37 0.015 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 36 0.020 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 36 0.020 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 36 0.026 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 36 0.026 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 36 0.034 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 35 0.045 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 35 0.045 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 35 0.060 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 34 0.079 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 34 0.079 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 34 0.10 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 34 0.10 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 34 0.10 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 34 0.10 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 34 0.10 At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing ... 34 0.10 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 34 0.10 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 34 0.10 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 34 0.10 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 34 0.10 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 34 0.10 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 34 0.10 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 33 0.14 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 33 0.14 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 33 0.14 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 33 0.14 At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing ... 33 0.24 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 33 0.24 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 33 0.24 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 33 0.24 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 0.24 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 33 0.24 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 33 0.24 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 32 0.32 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 32 0.32 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 32 0.32 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 32 0.32 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 32 0.32 At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein ... 32 0.42 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 32 0.42 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 32 0.42 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 32 0.42 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 31 0.56 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 31 0.56 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 31 0.56 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 31 0.74 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 31 0.74 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 31 0.74 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 31 0.74 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 31 0.74 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 31 0.98 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 31 0.98 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 31 0.98 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 30 1.3 At5g04210.1 68418.m00409 RNA recognition motif (RRM)-containing ... 30 1.3 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 30 1.3 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 30 1.3 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 30 1.7 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 30 1.7 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 29 2.3 At4g17720.1 68417.m02646 RNA recognition motif (RRM)-containing ... 29 2.3 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 2.3 At5g65750.1 68418.m08274 2-oxoglutarate dehydrogenase E1 compone... 29 3.0 At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RS... 29 3.0 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 29 3.0 At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing ... 29 3.0 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 29 3.0 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 29 3.0 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 29 3.9 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 5.2 At5g16840.1 68418.m01973 RNA recognition motif (RRM)-containing ... 28 5.2 At5g03480.1 68418.m00304 expressed protein ; expression support... 28 5.2 At4g08750.1 68417.m01443 RNA recognition motif (RRM)-containing ... 28 5.2 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 28 5.2 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 28 6.9 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 28 6.9 At4g24420.1 68417.m03501 RNA recognition motif (RRM)-containing ... 28 6.9 At5g51300.2 68418.m06360 splicing factor-related contains simila... 27 9.1 At5g51300.1 68418.m06359 splicing factor-related contains simila... 27 9.1 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 27 9.1 At2g47390.1 68415.m05915 expressed protein 27 9.1 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 27 9.1 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 27 9.1 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 27 9.1 At1g73490.1 68414.m08508 RNA recognition motif (RRM)-containing ... 27 9.1 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 27 9.1 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 63.7 bits (148), Expect = 1e-10 Identities = 31/81 (38%), Positives = 47/81 (58%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T + +LR+HF YGE+ V D TGR RGF F++F P +D+V Sbjct: 4 DQGKLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRV 63 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H+I+ ++VD K+A +R Sbjct: 64 LQE-KHSIDTREVDVKRAMSR 83 Score = 54.8 bits (126), Expect = 5e-08 Identities = 24/75 (32%), Positives = 41/75 (54%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 TD+E R +F YG + + + D T R RGF F+ F + +++D V+ H ++ K+V+ Sbjct: 122 TDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVE 181 Query: 438 PKKAKARHGKIFVGG 482 K+A + GG Sbjct: 182 VKRALPKDANPGGGG 196 Score = 54.8 bits (126), Expect = 5e-08 Identities = 23/62 (37%), Positives = 39/62 (62%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 R +F +G + +V + +D+ N+ +GF F++F+SE V+ +L GK+V+VKRA Sbjct: 127 RQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRAL 186 Query: 692 PK 697 PK Sbjct: 187 PK 188 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/60 (35%), Positives = 34/60 (56%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R F+ +G + + + DK + +GF F+ F S+P V D + K + +EVDVKRA Sbjct: 22 LREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIF-SDPSVLDRVLQEKHSIDTREVDVKRA 80 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 59.7 bits (138), Expect = 2e-09 Identities = 30/81 (37%), Positives = 45/81 (55%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T + LR++F +GE+ + V + TGR RGF F+ F P ID+V Sbjct: 4 DQGKLFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRV 63 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+N+ VD K+A +R Sbjct: 64 L-QDKHHIDNRDVDVKRAMSR 83 Score = 51.6 bits (118), Expect = 5e-07 Identities = 23/64 (35%), Positives = 35/64 (54%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 T E R +F YG + + D T R RGF F+ F + +S+D V+ H +N K+V+ Sbjct: 122 TSDEFRAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVE 181 Query: 438 PKKA 449 K+A Sbjct: 182 VKRA 185 Score = 48.0 bits (109), Expect = 6e-06 Identities = 22/62 (35%), Positives = 37/62 (59%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 R +F +G + + + D+T + +GF F++F+SE V+ +L GK+V+VKRA Sbjct: 127 RAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRAL 186 Query: 692 PK 697 PK Sbjct: 187 PK 188 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/60 (38%), Positives = 36/60 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R +FS FG +L+V + +K + +GF F+ F S+P V D + K ++VDVKRA Sbjct: 22 LREYFSNFGEVLQVTVMREKATGRPRGFGFVAF-SDPAVIDRVLQDKHHIDNRDVDVKRA 80 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 58.4 bits (135), Expect = 4e-09 Identities = 38/98 (38%), Positives = 48/98 (48%), Gaps = 11/98 (11%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K F TT+ HFG YGEI + D +TG+ RGF FI F P +DKV+ Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-E 78 Query: 405 GEHTINNKKVDPKKA--KARHG---------KIFVGGL 485 H IN K+V+ K+ K G KIFVGG+ Sbjct: 79 DTHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGI 116 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 6/73 (8%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTI 419 T+ EL+D F YG + V D T RSRGF F++F + E +D++++ G + + Sbjct: 121 TEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQV 180 Query: 420 NNKKVDPKKAKAR 458 KK +PKK+ R Sbjct: 181 EIKKAEPKKSLNR 193 Score = 48.0 bits (109), Expect = 6e-06 Identities = 22/64 (34%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLL-KTPKRTKGGKEVDVKR 685 +++FF+++G ++E ++ D N+ +GF F+ F+SE VV++LL K +V++K+ Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKK 184 Query: 686 ATPK 697 A PK Sbjct: 185 AEPK 188 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 F ++G I + + D+ Q +GF FITF ++P V D + GK+V++KR PK Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITF-ADPSVVDKVIEDTHVINGKQVEIKRTIPK 96 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 58.4 bits (135), Expect = 4e-09 Identities = 38/98 (38%), Positives = 48/98 (48%), Gaps = 11/98 (11%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K F TT+ HFG YGEI + D +TG+ RGF FI F P +DKV+ Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-E 78 Query: 405 GEHTINNKKVDPKKA--KARHG---------KIFVGGL 485 H IN K+V+ K+ K G KIFVGG+ Sbjct: 79 DTHVINGKQVEIKRTIPKGAGGNQSKDIKTKKIFVGGI 116 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/50 (40%), Positives = 31/50 (62%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 407 T+ EL+D F YG + V D T RSRGF F++F + E +D++++ G Sbjct: 121 TEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 41.9 bits (94), Expect = 4e-04 Identities = 16/43 (37%), Positives = 32/43 (74%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLL 637 +++FF+++G ++E ++ D N+ +GF F+ F+SE VV++LL Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 F ++G I + + D+ Q +GF FITF ++P V D + GK+V++KR PK Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITF-ADPSVVDKVIEDTHVINGKQVEIKRTIPK 96 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 57.6 bits (133), Expect = 7e-09 Identities = 24/67 (35%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVD 437 + EL+++F YG+I + D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+V+ Sbjct: 170 EDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVE 229 Query: 438 PKKAKAR 458 K+A+ + Sbjct: 230 IKRAEPK 236 Score = 51.2 bits (117), Expect = 6e-07 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 12/99 (12%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K F TT + ++FG +GE+ + TD TG RGF F+ F +KV+ Sbjct: 67 KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE 126 Query: 405 GEHTINNKKVDPK------------KAKARHGKIFVGGL 485 +H I+++KVD K KA ++ KIFVGGL Sbjct: 127 -DHVIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIFVGGL 164 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPK-RTKGGKEVDVKR 685 ++N+F +G I+E ++ +D + +GF F+TF++E V+ L K G K+V++KR Sbjct: 173 LKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKR 232 Query: 686 ATPK 697 A PK Sbjct: 233 AEPK 236 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +2 Query: 515 NFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATP 694 N+F +FG +++ + D+ +GF F+TF V +L+ ++VD+KR P Sbjct: 84 NYFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLP 142 Query: 695 K 697 + Sbjct: 143 R 143 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 57.2 bits (132), Expect = 1e-08 Identities = 29/81 (35%), Positives = 45/81 (55%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T ++ L+++FG YG++ + D TGR+RGF FIVF P ++V Sbjct: 13 DLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERV 72 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ + V+ KKA R Sbjct: 73 I-MDKHIIDGRTVEAKKAVPR 92 Score = 56.8 bits (131), Expect = 1e-08 Identities = 27/62 (43%), Positives = 39/62 (62%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 +N+F +FGTI +V + +D + +GF FITF+SE V+ +L GK V+VKRA Sbjct: 139 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAV 198 Query: 692 PK 697 PK Sbjct: 199 PK 200 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/64 (40%), Positives = 38/64 (59%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 T+ E +++F +G I + V D NT R RGF FI F + ES+D V+ H +N K V+ Sbjct: 134 TEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVE 193 Query: 438 PKKA 449 K+A Sbjct: 194 VKRA 197 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/63 (28%), Positives = 37/63 (58%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 ++ +F ++G ++E + D+T + +GF FI F ++P V + + K G+ V+ K+A Sbjct: 31 LQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVF-ADPSVAERVIMDKHIIDGRTVEAKKA 89 Query: 689 TPK 697 P+ Sbjct: 90 VPR 92 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/62 (41%), Positives = 39/62 (62%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 +N+F +FGTI +V + +D + +GF FITF+S+ V+ +L GK V+VKRA Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAV 186 Query: 692 PK 697 PK Sbjct: 187 PK 188 Score = 55.6 bits (128), Expect = 3e-08 Identities = 24/64 (37%), Positives = 40/64 (62%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 T++E +++F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ Sbjct: 122 TEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVE 181 Query: 438 PKKA 449 K+A Sbjct: 182 VKRA 185 Score = 55.2 bits (127), Expect = 4e-08 Identities = 30/81 (37%), Positives = 44/81 (54%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T ++ LRD+F YG++ + D TGR+RGF FIVF P ++V Sbjct: 4 DLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERV 63 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ + V+ KKA R Sbjct: 64 I-MDKHIIDGRTVEAKKAVPR 83 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/63 (30%), Positives = 38/63 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R++FS +G ++E + D+ + +GF FI F ++P V++ + K G+ V+ K+A Sbjct: 22 LRDYFSNYGDVVEAVIMRDRATGRARGFGFIVF-ADPCVSERVIMDKHIIDGRTVEAKKA 80 Query: 689 TPK 697 P+ Sbjct: 81 VPR 83 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/62 (41%), Positives = 39/62 (62%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 +N+F +FGTI +V + +D + +GF FITF+S+ V+ +L GK V+VKRA Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAV 186 Query: 692 PK 697 PK Sbjct: 187 PK 188 Score = 55.6 bits (128), Expect = 3e-08 Identities = 24/64 (37%), Positives = 40/64 (62%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 T++E +++F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ Sbjct: 122 TEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVE 181 Query: 438 PKKA 449 K+A Sbjct: 182 VKRA 185 Score = 55.2 bits (127), Expect = 4e-08 Identities = 30/81 (37%), Positives = 44/81 (54%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T ++ LRD+F YG++ + D TGR+RGF FIVF P ++V Sbjct: 4 DLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERV 63 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ + V+ KKA R Sbjct: 64 I-MDKHIIDGRTVEAKKAVPR 83 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/63 (30%), Positives = 38/63 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R++FS +G ++E + D+ + +GF FI F ++P V++ + K G+ V+ K+A Sbjct: 22 LRDYFSNYGDVVEAVIMRDRATGRARGFGFIVF-ADPCVSERVIMDKHIIDGRTVEAKKA 80 Query: 689 TPK 697 P+ Sbjct: 81 VPR 83 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/62 (41%), Positives = 39/62 (62%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 +N+F +FGTI +V + +D + +GF FITF+S+ V+ +L GK V+VKRA Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAV 186 Query: 692 PK 697 PK Sbjct: 187 PK 188 Score = 55.6 bits (128), Expect = 3e-08 Identities = 24/64 (37%), Positives = 40/64 (62%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 T++E +++F +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ Sbjct: 122 TEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVE 181 Query: 438 PKKA 449 K+A Sbjct: 182 VKRA 185 Score = 55.2 bits (127), Expect = 4e-08 Identities = 30/81 (37%), Positives = 44/81 (54%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T ++ LRD+F YG++ + D TGR+RGF FIVF P ++V Sbjct: 4 DLGKLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERV 63 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ + V+ KKA R Sbjct: 64 I-MDKHIIDGRTVEAKKAVPR 83 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/63 (30%), Positives = 38/63 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R++FS +G ++E + D+ + +GF FI F ++P V++ + K G+ V+ K+A Sbjct: 22 LRDYFSNYGDVVEAVIMRDRATGRARGFGFIVF-ADPCVSERVIMDKHIIDGRTVEAKKA 80 Query: 689 TPK 697 P+ Sbjct: 81 VPR 83 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/81 (35%), Positives = 46/81 (56%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 ++ K F T++ LRD+F ++GE+ + D TGR+RGF F+VF P ++V Sbjct: 4 ESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERV 63 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ K V+ KKA R Sbjct: 64 VLL-KHIIDGKIVEAKKAVPR 83 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/78 (33%), Positives = 40/78 (51%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 ++ K F T+ E + +F +G I + V D T R RGF FI + + E++DKV Sbjct: 104 NSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKV 163 Query: 396 MAAGEHTINNKKVDPKKA 449 + H +N K V+ K A Sbjct: 164 LQKTFHELNGKMVEVKLA 181 Score = 48.8 bits (111), Expect = 3e-06 Identities = 22/62 (35%), Positives = 38/62 (61%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 + +F++FG I +V + +D + +GF FI+++SE V+ +L+ GK V+VK A Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 182 Query: 692 PK 697 PK Sbjct: 183 PK 184 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/63 (31%), Positives = 36/63 (57%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R++F FG +LE + D+ + +GF F+ F ++P V + + K GK V+ K+A Sbjct: 22 LRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF-ADPNVAERVVLLKHIIDGKIVEAKKA 80 Query: 689 TPK 697 P+ Sbjct: 81 VPR 83 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/81 (35%), Positives = 46/81 (56%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 ++ K F T++ LRD+F ++GE+ + D TGR+RGF F+VF P ++V Sbjct: 4 ESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERV 63 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ K V+ KKA R Sbjct: 64 VLL-KHIIDGKIVEAKKAVPR 83 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/78 (33%), Positives = 40/78 (51%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 ++ K F T+ E + +F +G I + V D T R RGF FI + + E++DKV Sbjct: 104 NSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKV 163 Query: 396 MAAGEHTINNKKVDPKKA 449 + H +N K V+ K A Sbjct: 164 LQKTFHELNGKMVEVKLA 181 Score = 48.8 bits (111), Expect = 3e-06 Identities = 22/62 (35%), Positives = 38/62 (61%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 + +F++FG I +V + +D + +GF FI+++SE V+ +L+ GK V+VK A Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 182 Query: 692 PK 697 PK Sbjct: 183 PK 184 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/63 (31%), Positives = 36/63 (57%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R++F FG +LE + D+ + +GF F+ F ++P V + + K GK V+ K+A Sbjct: 22 LRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF-ADPNVAERVVLLKHIIDGKIVEAKKA 80 Query: 689 TPK 697 P+ Sbjct: 81 VPR 83 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 54.8 bits (126), Expect = 5e-08 Identities = 38/128 (29%), Positives = 55/128 (42%), Gaps = 9/128 (7%) Frame = +3 Query: 129 DSQDHNSAAAPGRDDDRCEXXXXXXXXXEDAMKTFCWWAELGTTDKELRDHFGAYGEIES 308 + + H+ + +DD + + A K F TT E HFG YGEI Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGGGVDSAGKIFVGGLARETTSAEFLKHFGKYGEITD 70 Query: 309 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG-------- 464 + D TG+ RGF F+ + +DKV+ H I K+V+ K+ R Sbjct: 71 SVIMKDRKTGQPRGFGFVTYADSSVVDKVI-QDNHIIIGKQVEIKRTIPRGSMSSNDFKT 129 Query: 465 -KIFVGGL 485 KIFVGG+ Sbjct: 130 KKIFVGGI 137 Score = 50.8 bits (116), Expect = 9e-07 Identities = 21/67 (31%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVD 437 D E ++ F +GE++ + D +TGRSRGF F+ +++ + +D ++A G ++ +V+ Sbjct: 143 DDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVE 202 Query: 438 PKKAKAR 458 KKA+ + Sbjct: 203 IKKAEPK 209 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/63 (36%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTK-GGKEVDVKRA 688 + FF +FG + E ++ D + + +GF F+T+ESE +V+ LL R + G +V++K+A Sbjct: 147 KEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKA 206 Query: 689 TPK 697 PK Sbjct: 207 EPK 209 Score = 35.9 bits (79), Expect = 0.026 Identities = 17/59 (28%), Positives = 33/59 (55%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 F ++G I + + D+ Q +GF F+T+ VV+ +++ GK+V++KR P+ Sbjct: 62 FGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 54.8 bits (126), Expect = 5e-08 Identities = 26/81 (32%), Positives = 46/81 (56%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T ++ L+++F ++GE+ + D TGR+RGF F+VF P ++ ++ Sbjct: 4 DNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEI 62 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ + V+ KKA R Sbjct: 63 VITEKHNIDGRLVEAKKAVPR 83 Score = 52.0 bits (119), Expect = 4e-07 Identities = 24/62 (38%), Positives = 36/62 (58%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 + +F +FGT +V + +D + +GF FIT++SE V +L GK V+VKRA Sbjct: 125 KTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAV 184 Query: 692 PK 697 PK Sbjct: 185 PK 186 Score = 47.6 bits (108), Expect = 8e-06 Identities = 20/63 (31%), Positives = 39/63 (61%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 ++ +FS FG ++E + D+T + +GF F+ F ++P V +++ T K G+ V+ K+A Sbjct: 22 LKEYFSSFGEVIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKA 80 Query: 689 TPK 697 P+ Sbjct: 81 VPR 83 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 54.8 bits (126), Expect = 5e-08 Identities = 26/81 (32%), Positives = 46/81 (56%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T ++ L+++F ++GE+ + D TGR+RGF F+VF P ++ ++ Sbjct: 4 DNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEI 62 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 + +H I+ + V+ KKA R Sbjct: 63 VITEKHNIDGRLVEAKKAVPR 83 Score = 52.0 bits (119), Expect = 4e-07 Identities = 24/62 (38%), Positives = 36/62 (58%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 + +F +FGT +V + +D + +GF FIT++SE V +L GK V+VKRA Sbjct: 125 KTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAV 184 Query: 692 PK 697 PK Sbjct: 185 PK 186 Score = 47.6 bits (108), Expect = 8e-06 Identities = 20/63 (31%), Positives = 39/63 (61%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 ++ +FS FG ++E + D+T + +GF F+ F ++P V +++ T K G+ V+ K+A Sbjct: 22 LKEYFSSFGEVIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKA 80 Query: 689 TPK 697 P+ Sbjct: 81 VPR 83 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 54.4 bits (125), Expect = 7e-08 Identities = 24/80 (30%), Positives = 44/80 (55%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K F TT++E + +F +G + V D T R RGF F+ + + +S++ VM + Sbjct: 121 KIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQS 180 Query: 405 GEHTINNKKVDPKKAKARHG 464 H +++K+V+ K+A + G Sbjct: 181 NFHELSDKRVEVKRAIPKEG 200 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/62 (33%), Positives = 36/62 (58%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 +++F FG +V + D N+ +GF F+T++SE V ++++ K V+VKRA Sbjct: 137 KSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAI 196 Query: 692 PK 697 PK Sbjct: 197 PK 198 Score = 41.9 bits (94), Expect = 4e-04 Identities = 25/82 (30%), Positives = 38/82 (46%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 D K F T+++ L+ +F YG + V + TG+ RGF F+ F + K Sbjct: 4 DRYKLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKA 63 Query: 396 MAAGEHTINNKKVDPKKAKARH 461 + H I K VD +KA +H Sbjct: 64 L-RDTHFILGKPVDVRKAIRKH 84 Score = 35.9 bits (79), Expect = 0.026 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKG--GKEVDVK 682 ++ +FS +G +LE + +K + +GF F+ F ++ D++K + T GK VDV+ Sbjct: 22 LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFAND---CDVVKALRDTHFILGKPVDVR 78 Query: 683 RATPK 697 +A K Sbjct: 79 KAIRK 83 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/78 (33%), Positives = 40/78 (51%) Frame = +3 Query: 216 DAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 395 ++ K F T+ E + +F +G I + V D T R RGF FI + + E++DKV Sbjct: 31 NSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKV 90 Query: 396 MAAGEHTINNKKVDPKKA 449 + H +N K V+ K A Sbjct: 91 LQKTFHELNGKMVEVKLA 108 Score = 48.8 bits (111), Expect = 3e-06 Identities = 22/62 (35%), Positives = 38/62 (61%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 + +F++FG I +V + +D + +GF FI+++SE V+ +L+ GK V+VK A Sbjct: 50 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 109 Query: 692 PK 697 PK Sbjct: 110 PK 111 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/61 (37%), Positives = 34/61 (55%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T + LR HF YGEI V D NTGRS+G+ F+ F+ PE+ + A I+ ++ Sbjct: 35 TQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRA 94 Query: 435 D 437 + Sbjct: 95 N 95 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R F ++G ILE + DK + KG+ F+TF P G+ + A Sbjct: 40 LRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLA 99 Query: 689 T---PKP 700 + P+P Sbjct: 100 SLGRPRP 106 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 49.6 bits (113), Expect = 2e-06 Identities = 27/100 (27%), Positives = 44/100 (44%) Frame = +3 Query: 99 LNGNAENGGGDSQDHNSAAAPGRDDDRCEXXXXXXXXXEDAMKTFCWWAELGTTDKELRD 278 ++G+ E GG D A D + D + F T++EL + Sbjct: 220 IDGDVEAGGVGKDDDGDAMEVEGDGKVAQESKAVSDDVLDTGRLFVRNLPYTATEEELME 279 Query: 279 HFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 HF +G+I +++ D T RSRG A+I++ PE + M Sbjct: 280 HFSTFGKISEVHLVLDKETKRSRGIAYILYLIPECAARAM 319 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 T +ELR F +G+I+S+ + N G+ G+AF+ F Sbjct: 681 TKRELRQLFSPFGQIKSMRL-PKKNIGQYAGYAFVEF 716 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/71 (33%), Positives = 39/71 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 TT + L+ F +YGEIE +V D +TGR +G+ F++FK + + + E + N+ V Sbjct: 419 TTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIV 478 Query: 435 DPKKAKARHGK 467 A + GK Sbjct: 479 VCNLASEKPGK 489 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 T + LR HF YG+I V TD NTGRS+G+ F+ F+ PE+ Sbjct: 35 TQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEA 77 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R F ++G ILE + DK + KG+ F+TF P G+ + A Sbjct: 40 LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGRRANCNLA 99 Query: 689 T 691 + Sbjct: 100 S 100 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/71 (29%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKV 434 T+++L DHF G++ +++ DP T SRGF FI K+ ++ + + +H++ + + Sbjct: 87 TERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVI 146 Query: 435 DPKKAKARHGK 467 +KA+ R G+ Sbjct: 147 TVEKARRRRGR 157 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKK 431 T+D+ LRD F YG + V D +GRSRGF FI F +++D+ +AA ++ + Sbjct: 18 TSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRT 77 Query: 432 VDPKKAKARHG 464 + KA+ G Sbjct: 78 ITVDKAQPHQG 88 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPK-RTKGGKEVDVKR 685 +R+ F ++G ++E ++ DK + +GF FITF+ + +++ + G+ + V + Sbjct: 23 LRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDK 82 Query: 686 ATP 694 A P Sbjct: 83 AQP 85 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 48.0 bits (109), Expect = 6e-06 Identities = 26/62 (41%), Positives = 33/62 (53%) Frame = +2 Query: 512 RNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT 691 R+ F +G I ++ MP D Q +G FITF S V DL++ GG V V RAT Sbjct: 108 RSHFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRAT 166 Query: 692 PK 697 PK Sbjct: 167 PK 168 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/60 (35%), Positives = 35/60 (58%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 L+D+ +G++E V D +TGRSRGF ++ F + E + GEH + N+ ++ K A Sbjct: 19 LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVA 77 Score = 41.1 bits (92), Expect = 7e-04 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 ++ + R HF YGEI + + D N+ + RG FI F + +S++ +M Sbjct: 103 SESDFRSHFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLM 149 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = +3 Query: 267 ELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 +LRD+FG +G I+ + DP RGF F+ F D+V A H I ++V Sbjct: 255 DLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-ARRSHEICGQEV 309 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/62 (33%), Positives = 34/62 (54%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R++F FG I + +P D ++ +GF F+TF +E V D + G+EV + A Sbjct: 256 LRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSA 314 Query: 689 TP 694 TP Sbjct: 315 TP 316 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/63 (28%), Positives = 37/63 (58%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 ++++ S+FG + + + D++ + +GF ++TF S + LK + G + ++VK A Sbjct: 19 LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVA 77 Query: 689 TPK 697 TPK Sbjct: 78 TPK 80 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/78 (30%), Positives = 35/78 (44%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K F T + LR+ F YGE+ + D TGRSRGFAF+ F + E M Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQL 94 Query: 405 GEHTINNKKVDPKKAKAR 458 ++ +++ A R Sbjct: 95 DGQDLHGRRIRVNYATER 112 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/63 (23%), Positives = 35/63 (55%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R FS++G +++ ++ D+ + +GF F+TF S ++ ++ + G+ + V A Sbjct: 50 LREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYA 109 Query: 689 TPK 697 T + Sbjct: 110 TER 112 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/61 (32%), Positives = 35/61 (57%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T E+R +F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K Sbjct: 28 TPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKA 87 Query: 435 D 437 + Sbjct: 88 N 88 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R +F +FG ILE + DK + KG+ F+TF + P G++ + A Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIA 92 Query: 689 T---PKP 700 + P+P Sbjct: 93 SFGRPRP 99 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/61 (32%), Positives = 35/61 (57%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T E+R +F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K Sbjct: 28 TPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKA 87 Query: 435 D 437 + Sbjct: 88 N 88 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R +F +FG ILE + DK + KG+ F+TF + P G++ + A Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIA 92 Query: 689 T---PKP 700 + P+P Sbjct: 93 SFGRPRP 99 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 46.0 bits (104), Expect = 2e-05 Identities = 27/64 (42%), Positives = 35/64 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 TTD EL+ FG YG I S V D G+SR F F+ F+ PE + + A +N KK Sbjct: 236 TTDDELKTTFGQYGSISSAVVMRD-GDGKSRCFGFVNFENPEDAARAVEA----LNGKKF 290 Query: 435 DPKK 446 D K+ Sbjct: 291 DDKE 294 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 TD++LR+ F +G I S V DP +G S+G F+ F A +V+ Sbjct: 340 TDEKLRELFAEFGTITSCKVMRDP-SGTSKGSGFVAFSAASEASRVL 385 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/58 (36%), Positives = 29/58 (50%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 K F GT D L+ F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 34.7 bits (76), Expect = 0.060 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK-TPKRTKGGKEVDVKR 685 ++ F+ FG + E + D+ + +GF F++F E N+ +K + G+++ V Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNL 110 Query: 686 ATPK 697 AT + Sbjct: 111 ATER 114 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/58 (36%), Positives = 29/58 (50%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 K F GT D L+ F ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 34.7 bits (76), Expect = 0.060 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK-TPKRTKGGKEVDVKR 685 ++ F+ FG + E + D+ + +GF F++F E N+ +K + G+++ V Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNL 110 Query: 686 ATPK 697 AT + Sbjct: 111 ATER 114 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 45.2 bits (102), Expect = 4e-05 Identities = 18/49 (36%), Positives = 32/49 (65%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 TT+++L+D F ++G++ V TD ++GRS+GF F+ + E +K A Sbjct: 45 TTNEKLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 +++ F+ FG +++ + D+ + KGF F+T+ Sbjct: 50 LQDAFASFGQLVDARVITDRDSGRSKGFGFVTY 82 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/60 (35%), Positives = 33/60 (55%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 TT + L+ F YGEI +V D +TGR++GF F++FK + + E + N+ V Sbjct: 174 TTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATP 694 F +G I E + DK + KGF F+ F++ LK P++ + V A P Sbjct: 183 FEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARP 240 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 44.4 bits (100), Expect = 7e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 264 KELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 362 KELR HF GE+ ++V TD TG SRGFA+I Sbjct: 497 KELRSHFSKCGEVTRVHVPTDRETGASRGFAYI 529 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 44.4 bits (100), Expect = 7e-05 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 L +HF AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 183 LLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 TT + LR F +YG++E V D TG+S+G+ F+ F Sbjct: 86 TTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTF 123 Score = 31.9 bits (69), Expect = 0.42 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGK 667 +R+ FS +G + E + DK + KG+ F+TF LK P + G+ Sbjct: 91 LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGR 143 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +2 Query: 515 NFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 N F +G + E + FDK + +GF +++ L P + GK ++ K A Sbjct: 185 NHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 44.4 bits (100), Expect = 7e-05 Identities = 23/60 (38%), Positives = 33/60 (55%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 L +HF AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 183 LLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 TT + LR F +YG++E V D TG+S+G+ F+ F Sbjct: 86 TTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTF 123 Score = 31.9 bits (69), Expect = 0.42 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGK 667 +R+ FS +G + E + DK + KG+ F+TF LK P + G+ Sbjct: 91 LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGR 143 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +2 Query: 515 NFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 N F +G + E + FDK + +GF +++ L P + GK ++ K A Sbjct: 185 NHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/48 (43%), Positives = 25/48 (52%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 K F GT D LRD F +G++ V D TGRSRGF F+ F Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/65 (21%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLL-KTPKRTKGGKEVDVKR 685 +R+ F+ FG +++ ++ D+ + +GF F+ F E + + + G+ + V Sbjct: 51 LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNP 110 Query: 686 ATPKP 700 A +P Sbjct: 111 ANDRP 115 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/48 (43%), Positives = 25/48 (52%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 K F GT D LRD F +G++ V D TGRSRGF F+ F Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/65 (21%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLL-KTPKRTKGGKEVDVKR 685 +R+ F+ FG +++ ++ D+ + +GF F+ F E + + + G+ + V Sbjct: 51 LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNP 110 Query: 686 ATPKP 700 A +P Sbjct: 111 ANDRP 115 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKK 431 T D+ L F YG++ + D TGRSRGF F+ FK +++ D + ++ + Sbjct: 19 TDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRS 78 Query: 432 VDPKKAKAR 458 + +A++R Sbjct: 79 ITVNEAQSR 87 Score = 31.9 bits (69), Expect = 0.42 Identities = 10/40 (25%), Positives = 26/40 (65%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK 640 F+++G +++ ++ D+ + +GF F+TF+ E + D ++ Sbjct: 28 FAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIE 67 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKK 431 T D+ L F YG++ + D TGRSRGF F+ FK +++ D + ++ + Sbjct: 19 TDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRS 78 Query: 432 VDPKKAKAR 458 + +A++R Sbjct: 79 ITVNEAQSR 87 Score = 31.9 bits (69), Expect = 0.42 Identities = 10/40 (25%), Positives = 26/40 (65%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK 640 F+++G +++ ++ D+ + +GF F+TF+ E + D ++ Sbjct: 28 FAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIE 67 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/59 (30%), Positives = 35/59 (59%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T+++L DHF G++ +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 57 TERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 TD +LR+HF +G I S V DP +G SRG F+ F PE + + Sbjct: 339 TDDKLREHFAPFGTITSCKVMRDP-SGVSRGSGFVAFSTPEEATRAI 384 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 264 KELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 K L + F A+G I S V DP +G+S+G+ F+ + E+ Sbjct: 147 KALHETFSAFGPILSCKVAVDP-SGQSKGYGFVQYDTDEA 185 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/61 (31%), Positives = 34/61 (55%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T E+R +F +GEI + TD TG+S+G+ F+ F+ +S + +A I+ +K Sbjct: 28 TPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKA 87 Query: 435 D 437 + Sbjct: 88 N 88 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 +R +F +FG ILE + DK + KG+ F+TF + P G++ + A Sbjct: 33 MRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKANCNIA 92 Query: 689 T---PKP 700 + P+P Sbjct: 93 SFGRPRP 99 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 + LR+ F YGE+ V D TGRSRGF F+ F + E+ + A Sbjct: 53 EDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKT-PKRTKGGKEVDVKR 685 +R F+++G +++ + D+ + +GF F+TF S + ++ R G+ V V Sbjct: 56 LREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNY 115 Query: 686 ATPK 697 A + Sbjct: 116 ANDR 119 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 42.3 bits (95), Expect = 3e-04 Identities = 23/65 (35%), Positives = 33/65 (50%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T + L +F +GEI V D T RS+GF F+ F+ ES + HTI+ + V Sbjct: 20 TRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTV 79 Query: 435 DPKKA 449 + K A Sbjct: 80 NCKLA 84 Score = 35.1 bits (77), Expect = 0.045 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 515 NFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 ++F FG I+ ++ D + KGF F+TF + P T G+ V+ K A Sbjct: 27 SYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/64 (40%), Positives = 37/64 (57%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 TTD +L++ FG YG+I S V D G+S+GF F+ F E+ D A E ++N K Sbjct: 40 TTDDDLKNAFGEYGKITSAVVMKD-GEGKSKGFGFVNF---ENADDAARAVE-SLNGHKF 94 Query: 435 DPKK 446 D K+ Sbjct: 95 DDKE 98 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 +D++L++ F +G + S V DPN G S+G F+ F PE + M+ Sbjct: 144 SDEKLKEIFSPFGTVTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/68 (32%), Positives = 34/68 (50%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K F + TT + L F YGEIE V D TG+++GF F++FK + + + Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKE 164 Query: 405 GEHTINNK 428 + I N+ Sbjct: 165 PKKRILNR 172 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKR 652 F +G I E + DK + KGF F+ F++ + LK PK+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKK 167 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/68 (32%), Positives = 34/68 (50%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 K F + TT + L F YGEIE V D TG+++GF F++FK + + + Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKE 164 Query: 405 GEHTINNK 428 + I N+ Sbjct: 165 PKKRILNR 172 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKR 652 F +G I E + DK + KGF F+ F++ + LK PK+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKK 167 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 +R +F +GEI V TD NTGRS+G+ F+ FK E+ Sbjct: 38 MRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 610 +R +F +FG I+E + DK + KG+ F+TF+ Sbjct: 38 MRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFK 71 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 41.5 bits (93), Expect = 5e-04 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +3 Query: 255 TTDKE-LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 431 TT KE L + F +GEI +NV D T RS+G+ F+ FK ES + TI + Sbjct: 23 TTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRI 82 Query: 432 VDPKKA 449 + K A Sbjct: 83 TNCKLA 88 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +2 Query: 515 NFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 NFF FG I+ V + D+ ++ +G+ F+TF+ K P T G+ + K A Sbjct: 31 NFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLA 88 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 41.1 bits (92), Expect = 7e-04 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 6/68 (8%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTI 419 TD++L F +G+I + + +TGRSRGF FI F ++D+ + G+ I Sbjct: 19 TDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVI 78 Query: 420 NNKKVDPK 443 + + +PK Sbjct: 79 SVNRAEPK 86 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPK-RTKGGKEVDVKRATPK 697 FS FG IL+ ++ ++ + +GF FITF +++ ++ R G + + V RA PK Sbjct: 27 FSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/61 (32%), Positives = 33/61 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T D++L+ F +G++ + D +GRSRGF F+ FK +K M +N K++ Sbjct: 17 TNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKEL 72 Query: 435 D 437 D Sbjct: 73 D 73 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/56 (28%), Positives = 33/56 (58%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVD 676 ++ FS+FG +++ ++ D+ + +GF F+TF+ E + D ++ GKE+D Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/61 (32%), Positives = 33/61 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T D++L+ F +G++ + D +GRSRGF F+ FK +K M +N K++ Sbjct: 17 TNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKEL 72 Query: 435 D 437 D Sbjct: 73 D 73 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/56 (28%), Positives = 33/56 (58%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVD 676 ++ FS+FG +++ ++ D+ + +GF F+TF+ E + D ++ GKE+D Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/61 (32%), Positives = 33/61 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T D++L+ F +G++ + D +GRSRGF F+ FK +K M +N K++ Sbjct: 17 TNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKEL 72 Query: 435 D 437 D Sbjct: 73 D 73 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/56 (28%), Positives = 33/56 (58%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVD 676 ++ FS+FG +++ ++ D+ + +GF F+TF+ E + D ++ GKE+D Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 41.1 bits (92), Expect = 7e-04 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +3 Query: 249 LGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKV 395 + T++ELR HF G I S + D G+S+GF F+ F P E+ID V Sbjct: 313 VAVTEEELRKHFSQCGTITSTKLMCDEK-GKSKGFGFVCFSTPEEAIDAV 361 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 419 T+ L+D F +G I S V T + G+SRG+ F+ F+ ++ + TI Sbjct: 124 TNAVLQDMFKKFGNIVSCKVATLED-GKSRGYGFVQFEQEDAAHAAIQTLNSTI 176 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 LR++F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 +RN+F +FG I+E + DK+ + KG+ F+TF Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 LR++F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 +RN+F +FG I+E + DK+ + KG+ F+TF Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/42 (47%), Positives = 26/42 (61%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 TD EL+ FG YG+I S V D +G SR F F+ F +PE+ Sbjct: 237 TDDELKKTFGKYGDISSAVVMKD-QSGNSRSFGFVNFVSPEA 277 Score = 34.7 bits (76), Expect = 0.060 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 380 D++L++ F YG + S V + + G SRGF F+ + PE Sbjct: 341 DEKLKEMFSEYGNVTSCKVMMN-SQGLSRGFGFVAYSNPE 379 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 FS FGTIL ++ D + KG+ F+ FE E Sbjct: 152 FSSFGTILSCKVAMD-VVGRSKGYGFVQFEKE 182 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 8/80 (10%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGE 410 TT +L F YG++ + + D TG SRGFAF+ + KA E +D +V+ E Sbjct: 27 TTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGRE 86 Query: 411 HTINNKKVDPKKAKARHGKI 470 T+ K P K G++ Sbjct: 87 ITVQFAKYGPNAEKISKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 8/80 (10%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGE 410 TT +L F YG++ + + D TG SRGFAF+ + KA E +D +V+ E Sbjct: 27 TTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGRE 86 Query: 411 HTINNKKVDPKKAKARHGKI 470 T+ K P K G++ Sbjct: 87 ITVQFAKYGPNAEKISKGRV 106 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 GT + L+D F ++ + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 41 GTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKK 431 TTD LR+ F YG + V D T RSRGF F+ + + + ++ + +N ++ Sbjct: 14 TTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRR 73 Query: 432 VDPK 443 V K Sbjct: 74 VSVK 77 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 613 +R FS +G +++ + D+ ++ +GF F+T+ S Sbjct: 19 LREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSS 53 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 518 FFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT-- 691 FFS+FG I E + DK + KGFC ++S L+ P +T G + ++A Sbjct: 264 FFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKAIDG 323 Query: 692 PKP 700 PKP Sbjct: 324 PKP 326 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPKP 700 F ++G I + + FDK + KG+ FI ++S + LK P++ G + + A+ P Sbjct: 160 FKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 282 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 34.3 bits (75), Expect = 0.079 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 374 T + L + F YGEIE D +G+S+G+ FI++K+ Sbjct: 151 TKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 518 FFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT-- 691 FFS+FG I E + DK + KGFC ++S L+ P +T G + ++A Sbjct: 264 FFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKAIDG 323 Query: 692 PKP 700 PKP Sbjct: 324 PKP 326 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPKP 700 F ++G I + + FDK + KG+ FI ++S + LK P++ G + + A+ P Sbjct: 160 FKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 282 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 34.3 bits (75), Expect = 0.079 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 374 T + L + F YGEIE D +G+S+G+ FI++K+ Sbjct: 151 TKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 518 FFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRAT-- 691 FFS+FG I E + DK + KGFC ++S L+ P +T G + ++A Sbjct: 264 FFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKAIDG 323 Query: 692 PKP 700 PKP Sbjct: 324 PKP 326 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPKP 700 F ++G I + + FDK + KG+ FI ++S + LK P++ G + + A+ P Sbjct: 160 FKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 282 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 449 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 34.3 bits (75), Expect = 0.079 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 374 T + L + F YGEIE D +G+S+G+ FI++K+ Sbjct: 151 TKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 T + L+D FG + V + NTGRSRGF FI F++ E++ +A Sbjct: 231 TSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALA 278 Score = 34.7 bits (76), Expect = 0.060 Identities = 16/58 (27%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTK-GGKEVDV 679 + F E GT+++V++ +DK ++ +GF F+T S + ++ ++ GG+ V V Sbjct: 132 LSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 Score = 34.3 bits (75), Expect = 0.079 Identities = 20/75 (26%), Positives = 32/75 (42%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 T EL FG G + + + D T RSRGF F+ + E + M N+ ++ Sbjct: 128 TSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAM----QMFNSSQIG 183 Query: 438 PKKAKARHGKIFVGG 482 + K ++ GG Sbjct: 184 GRTVKVNFPEVPRGG 198 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 K F ++ L+D F ++GE+ + + D +GRSRGF F+ F Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 Score = 34.7 bits (76), Expect = 0.060 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 +++ FS FG + EV + +DK + +GF F+ F E Sbjct: 57 LKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEE 92 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/78 (25%), Positives = 39/78 (50%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 431 G ++++L+ FG GE+ + + +P T +S+G AF+ F E + + + + N K Sbjct: 224 GASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGK 283 Query: 432 VDPKKAKARHGKIFVGGL 485 A + +FVG + Sbjct: 284 KCGVTASQDNDTLFVGNI 301 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 ++ +RD YG++E + + + + R + F F+ F E+ V A INN ++ Sbjct: 404 EERVRDLLKPYGKLEKVELARNMPSARRKDFGFVTFDTHEA--AVSCA--KFINNSELGE 459 Query: 441 KKAKAR 458 + KA+ Sbjct: 460 GEDKAK 465 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKT-PKRTKGGKEVDVKR 685 + + FSE G ++E + +D+ + KGF F+T++S V + +K+ G+++ V Sbjct: 220 LESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSE 279 Query: 686 ATPKP 700 A +P Sbjct: 280 AEARP 284 Score = 35.9 bits (79), Expect = 0.026 Identities = 23/81 (28%), Positives = 36/81 (44%) Frame = +3 Query: 222 MKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 +K F +L F + G +E + V D TGRSRGF F+ S+ +V A Sbjct: 91 LKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEA 147 Query: 402 AGEHTINNKKVDPKKAKARHG 464 A + N ++D + + G Sbjct: 148 AAQQ-FNGYELDGRPLRVNAG 167 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/70 (22%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNK 428 G D L F G++ V D ++GRS+GF F+ + + + + + + + ++ + Sbjct: 214 GVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGR 273 Query: 429 KVDPKKAKAR 458 ++ +A+AR Sbjct: 274 QIRVSEAEAR 283 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKV 434 T+++L F YG+I + +TGR RGF FI F D + + NK + Sbjct: 24 TERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVI 83 Query: 435 DPKKAKARHG 464 KA+ + G Sbjct: 84 SVNKAEPKVG 93 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK-TPKRTKGGKEVDVKR 685 + + F +G I E ++ + + +GF FITF +D +K R G K + V + Sbjct: 28 LESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNK 87 Query: 686 ATPK 697 A PK Sbjct: 88 AEPK 91 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKV 434 T+++L F YG+I + +TGR RGF FI F D + + NK + Sbjct: 24 TERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVI 83 Query: 435 DPKKAKARHG 464 KA+ + G Sbjct: 84 SVNKAEPKVG 93 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK-TPKRTKGGKEVDVKR 685 + + F +G I E ++ + + +GF FITF +D +K R G K + V + Sbjct: 28 LESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNK 87 Query: 686 ATPK 697 A PK Sbjct: 88 AEPK 91 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 LR+HF +G I S V D TGR+R FAF+ F + E D ++ Sbjct: 228 LRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 613 +RN FS+FGTI+ + D+ + + F F++F S Sbjct: 228 LRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTS 262 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 267 ELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT 416 +L D F +G + S+ V +P TG SRG ++ + S +A+ + T Sbjct: 123 QLLDMFQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGT 172 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 T+ +L F YGEI +N+ D TG+S+GFAF+ ++ S Sbjct: 48 TEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 FS++G I++V + DK + KGF F+ +E + Sbjct: 56 FSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQ 87 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/33 (45%), Positives = 25/33 (75%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 LR+HF + GEI++++V D +TG S+G A++ F Sbjct: 421 LREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEV 673 + NFF E G +++V ++ +GF + F S L+ R G+E+ Sbjct: 313 VENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEFASSEEAQKALEFHGRPLLGREI 367 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +3 Query: 267 ELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 ++ + F GE+ + T+ + G RGF + F + E K + Sbjct: 312 DVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEFASSEEAQKAL 355 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 TTD+ LR F +G+I+ + D T R +GF FI F + + K + Sbjct: 18 TTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKAL 65 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKT 643 +R FS FG I E + D + KGF FITF+SE LK+ Sbjct: 23 LRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALKS 67 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 +R+ F +FG ++ + M DK N+ KGF F+ +E+E Sbjct: 93 LRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETE 128 Score = 35.9 bits (79), Expect = 0.026 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH--TINNK 428 TT+ LRD F +G + +N+ D R +GFAF+ ++ E K + G H ++ + Sbjct: 88 TTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKAI-QGMHGKFLDGR 146 Query: 429 KVDPKKAKAR 458 + ++AK R Sbjct: 147 VIFVEEAKTR 156 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 371 T D++L+ F +G++ + D +GRSRGF F+ FK Sbjct: 17 TNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 Score = 37.5 bits (83), Expect = 0.009 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGG 664 ++ FS+FG +++ ++ D+ + +GF F+TF+ E + D ++ + GG Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGSGGG 73 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/77 (19%), Positives = 42/77 (54%), Gaps = 1/77 (1%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE-SIDKVMAAGEHTINNKKV 434 T+ +L+ G+ GE+ + + + ++G +G+AF+ F++ + + + + K++ Sbjct: 104 TEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRI 163 Query: 435 DPKKAKARHGKIFVGGL 485 +A+H ++F+G + Sbjct: 164 KCSTTQAKH-RLFLGNV 179 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRT 655 ++ F G + EV + +K KG+ F+TF S+ + + + T T Sbjct: 108 LKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNT 156 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/47 (44%), Positives = 25/47 (53%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 TD L F YG + S+ V D GRSRGF F+ F PE+ K M Sbjct: 214 TDDCLHTLFSQYGTVSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 Score = 35.9 bits (79), Expect = 0.026 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 + LR+ FG YG+I S V N GRS+GF F+ F Sbjct: 317 ETRLREIFGCYGQIVSAKVMCHEN-GRSKGFGFVCF 351 Score = 31.5 bits (68), Expect = 0.56 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT 416 T+K+L D F + S+++ + TG+S +A+I F +P S M H+ Sbjct: 33 TEKDLIDKFSLNVPVVSVHLCRNSVTGKSMCYAYINFDSPFSASNAMTRLNHS 85 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 G T L HF +GE+ + TDP TG+ G A+I F E+ + ++ Sbjct: 526 GATKDSLSRHFNKFGEVLKAFIVTDPATGQPSGSAYIEFTRKEAAENALS 575 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 258 TDKE-LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T KE ++ HF +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ Sbjct: 24 THKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRA 83 Query: 435 D 437 + Sbjct: 84 N 84 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 ++ F +FG ILE + DK + KG+ F+TF Sbjct: 29 MKKHFEQFGEILEAVVITDKASGRSKGYGFVTF 61 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 258 TDKE-LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T KE ++ HF +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ Sbjct: 24 THKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRA 83 Query: 435 D 437 + Sbjct: 84 N 84 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 ++ F +FG ILE + DK + KG+ F+TF Sbjct: 29 MKKHFEQFGEILEAVVITDKASGRSKGYGFVTF 61 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 258 TDKE-LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T KE ++ HF +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ Sbjct: 24 THKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRA 83 Query: 435 D 437 + Sbjct: 84 N 84 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 ++ F +FG ILE + DK + KG+ F+TF Sbjct: 29 MKKHFEQFGEILEAVVITDKASGRSKGYGFVTF 61 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 ++ +LR F A+G +E + + DP TG+ +GF FI F Sbjct: 277 SELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQF 313 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 +R F FG + V++P D Q KGF FI F Sbjct: 281 LRQIFEAFGPVELVQLPLDPETGQCKGFGFIQF 313 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = +3 Query: 261 DKELRDHFGAYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 428 +K L D F A+G I S + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 125 EKLLYDTFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T+ ++R+ ++G + N+ D TG S+G+AF V++ P D AA Sbjct: 387 TEVQIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +3 Query: 255 TTDKEL-RDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 431 +TD EL ++ FG++G+I V D +G SRGF F+ + + E + M A + NK+ Sbjct: 46 STDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA----MQNKE 101 Query: 432 VD 437 +D Sbjct: 102 LD 103 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK 640 ++ F FG I++ + D+ +GF F+T++S V N+ ++ Sbjct: 52 LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQ 95 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 258 TDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 TD L++ F Y + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 128 TDYLLQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/69 (26%), Positives = 34/69 (49%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 ++++R FG G ++SI + +TG+ RG A+ F E + +A KK+ Sbjct: 664 EEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISI 723 Query: 441 KKAKARHGK 467 ++ + GK Sbjct: 724 ARSNPKKGK 732 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/63 (20%), Positives = 29/63 (46%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 IR FF + G + + + K + +G + F + + + ++ GK++ + R+ Sbjct: 667 IRKFFGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARS 726 Query: 689 TPK 697 PK Sbjct: 727 NPK 729 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/69 (26%), Positives = 34/69 (49%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 ++++R FG G ++SI + +TG+ RG A+ F E + +A KK+ Sbjct: 664 EEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISI 723 Query: 441 KKAKARHGK 467 ++ + GK Sbjct: 724 ARSNPKKGK 732 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/63 (20%), Positives = 29/63 (46%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 IR FF + G + + + K + +G + F + + + ++ GK++ + R+ Sbjct: 667 IRKFFGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARS 726 Query: 689 TPK 697 PK Sbjct: 727 NPK 729 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 264 KELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK 443 ++L + F +GEIE + D TGR +GFA V+++ ES K + T + Sbjct: 241 QKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCH 300 Query: 444 KA 449 KA Sbjct: 301 KA 302 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 374 T L D F YGEIE D +G+S+G+ FI+FK+ Sbjct: 139 TKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKS 178 Score = 35.1 bits (77), Expect = 0.045 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +2 Query: 518 FFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRATPK 697 FFS FG I E + DK + KGF + S L+ P +T G + +A Sbjct: 246 FFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKANDG 305 Query: 698 P 700 P Sbjct: 306 P 306 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 371 TD L D F A+ V D TGRSRGF F+ F+ Sbjct: 160 TDAALFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 TDK+L HF G++ S + +P T SRGFAF+ + + ++ Sbjct: 84 TDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER 128 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 TDK+L HF G++ S + +P T SRGFAF+ + + ++ Sbjct: 83 TDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER 127 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +3 Query: 255 TTDKELRDH-FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNK 428 T KE+ ++ F G++ S V P T +S GF F+ F + E ++ ++A + + Sbjct: 187 TVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQ 246 Query: 429 KVDPKKA 449 K+ KA Sbjct: 247 KIRVNKA 253 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 T+++L +G +E + V D +GRSR F F K+ E + V+ Sbjct: 88 TNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV 134 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 + N FSE G ++ ++ ++ GF F+TF SE Sbjct: 193 LENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSE 228 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/61 (31%), Positives = 33/61 (54%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTKGGKEVDVKRA 688 I F+EFG + + ++ D+ + KGF F+TF+ E D ++T G+E+D + Sbjct: 60 IERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDE----DSMRTAIDRMNGQELDGRNI 115 Query: 689 T 691 T Sbjct: 116 T 116 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 386 T ++ + F +GE+ + D TGRS+GF F+ FK +S+ Sbjct: 55 TDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 37.5 bits (83), Expect = 0.009 Identities = 14/50 (28%), Positives = 31/50 (62%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T ++++ + FG +GEI+++N+ D +G +G+A I ++ E ++A Sbjct: 106 TQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISA 155 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 I N F +FG I + + D+ KG+ I +E + Sbjct: 111 ITNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKK 146 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 380 D++L++ F YG + S V +P G SRGF F+ + PE Sbjct: 345 DEKLKEMFSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPE 383 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 +K L + F ++G I S V D TGRS+G+ F+ F+ ES Sbjct: 149 NKALFETFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEES 188 Score = 31.5 bits (68), Expect = 0.56 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 FS FGTIL ++ D T + KG+ F+ FE E Sbjct: 156 FSSFGTILSCKVAMDVT-GRSKGYGFVQFEKE 186 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 258 TDKE-LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T KE + DHF YG+I + +D T RS+G+ F+ FK ++ + IN ++ Sbjct: 28 THKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRRA 87 Query: 435 D 437 + Sbjct: 88 N 88 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFE 610 F ++G ILE + DK + KG+ F+TF+ Sbjct: 37 FIKYGDILEAVIISDKLTRRSKGYGFVTFK 66 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVM 398 T +K+L D F +G + + D +TG+SR F F+ F+ +S+ D +M Sbjct: 18 TDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAIM 66 Score = 34.7 bits (76), Expect = 0.060 Identities = 12/43 (27%), Positives = 27/43 (62%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLL 637 + + FS+FG +++ ++ +D+ + + F F+TFE E + D + Sbjct: 23 LTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAI 65 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 36.7 bits (81), Expect = 0.015 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = +3 Query: 219 AMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-V 395 A K F TT++ L + F G++ + D + RS+GF F+ F + + K + Sbjct: 33 ASKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKAL 92 Query: 396 MAAGEHTINNKKVDPKKAKAR 458 M +N + + AKA+ Sbjct: 93 MEFNGQQLNGRTIFVDYAKAK 113 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFES 613 FS+ G ++E ++ D+ ++ KGF F+TF S Sbjct: 54 FSKCGQVVEAQIVMDRVSDRSKGFGFVTFAS 84 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTK-GGKEVDVKR 685 + N F+E G ++E + +D+ + KGF F+T S V + + G+++ V Sbjct: 265 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSE 324 Query: 686 ATPKP 700 A +P Sbjct: 325 AEARP 329 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK 428 G D L + F G++ V D ++GRS+GF F+ + + + K + + ++ + Sbjct: 259 GVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGR 318 Query: 429 KVDPKKAKAR 458 ++ +A+AR Sbjct: 319 QIRVSEAEAR 328 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/56 (28%), Positives = 24/56 (42%) Frame = +3 Query: 222 MKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 389 +K F +L F + G +E + V D TGRSRGF F+ ++ Sbjct: 99 LKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPKRTK-GGKEVDVKR 685 + N F+E G ++E + +D+ + KGF F+T S V + + G+++ V Sbjct: 273 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSE 332 Query: 686 ATPKP 700 A +P Sbjct: 333 AEARP 337 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/70 (24%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK 428 G D L + F G++ V D ++GRS+GF F+ + + + K + + ++ + Sbjct: 267 GVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGR 326 Query: 429 KVDPKKAKAR 458 ++ +A+AR Sbjct: 327 QIRVSEAEAR 336 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/56 (28%), Positives = 24/56 (42%) Frame = +3 Query: 222 MKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 389 +K F +L F + G +E + V D TGRSRGF F+ ++ Sbjct: 99 LKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 36.3 bits (80), Expect = 0.020 Identities = 22/89 (24%), Positives = 38/89 (42%) Frame = +3 Query: 132 SQDHNSAAAPGRDDDRCEXXXXXXXXXEDAMKTFCWWAELGTTDKELRDHFGAYGEIESI 311 + D +P D+DR E + F +++LRD GEI + Sbjct: 87 ADDDEKPPSPIDDEDR-EKYSHLLSLPPHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEV 145 Query: 312 NVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 + D ++G S+G+AF+ FK + K + Sbjct: 146 RLMKDRDSGDSKGYAFVAFKTKDVAQKAI 174 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 258 TDKELRDHFGAYGE-IESINVKTDP-NTGRSRGFAFIVF 368 T+ E R G +E+I + DP NT R+RGFAF+++ Sbjct: 208 TEDEFRKVIEDVGPGVENIELIKDPTNTTRNRGFAFVLY 246 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 36.3 bits (80), Expect = 0.020 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKTPK-RTKGGKEVDVKRATPK 697 FSE G + + +K ++ +GF F+ F + VN ++ T GG+ + VK+A + Sbjct: 40 FSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAHR 99 Query: 698 P 700 P Sbjct: 100 P 100 Score = 35.1 bits (77), Expect = 0.045 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAA 404 T +E++ F +GE+ES+++ T R G AF+ FK A S+ + AA Sbjct: 573 TKEEVKQRFTVFGEVESLSLVLHKVTKRPEGTAFVKFKTADASVAAISAA 622 Score = 33.1 bits (72), Expect = 0.18 Identities = 16/68 (23%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKV 434 T+ +L + F G + + T+ + RGFAF+ F E +++ + T+ +++ Sbjct: 32 TNAQLEEAFSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRI 91 Query: 435 DPKKAKAR 458 K+A R Sbjct: 92 TVKQAAHR 99 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 TT + LR F +GE+ V TD +G S+GF F+ + E K +A Sbjct: 67 TTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIA 115 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 +R F++FG + + ++ D+ KGF F+ + Sbjct: 72 LRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRY 104 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 35.9 bits (79), Expect = 0.026 Identities = 13/32 (40%), Positives = 24/32 (75%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFESE 616 FS++G +L+V++ DK + + KGF ++TF S+ Sbjct: 41 FSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSK 72 Score = 35.5 bits (78), Expect = 0.034 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 +T++ L F YG++ ++V D R +GFA++ F + E +K + Sbjct: 32 STEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKAL 79 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 35.5 bits (78), Expect = 0.034 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 8/75 (10%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG-------- 407 G + E+ F +G ++ + V + TG+S+ F FI F+ PE + +AAG Sbjct: 70 GFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAE--IAAGAMNDYLLM 127 Query: 408 EHTINNKKVDPKKAK 452 EH + ++P+ K Sbjct: 128 EHMLKVHVIEPENVK 142 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPV 622 I FFS+FGT+ V + +K + K F FI FE V Sbjct: 76 IEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEV 113 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +3 Query: 249 LGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 419 L +LRD F +G ++ I + + TG RGF F+ ++ E + M H + Sbjct: 56 LDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKV 112 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/58 (20%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEPVVNDLLKTPKRTKGGKEVDV 679 +R+ F FG + ++ +P + + +GF F+ + +E + + + GG+E+ + Sbjct: 63 LRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAI 120 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 35.1 bits (77), Expect = 0.045 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 413 +T+++L +G + + V + N+G SRGFAFI F ++ +M EH Sbjct: 309 STEEDLYQILAEWGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 Score = 35.1 bits (77), Expect = 0.045 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKK 431 ++ LR F + I+ + + D T SRGFAF+ F + E K + A T N K Sbjct: 471 EEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKI 530 Query: 432 VDPKKAKARHG 464 + AK+ HG Sbjct: 531 LRVAYAKSVHG 541 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 34.7 bits (76), Expect = 0.060 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 225 KTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 K F T++K LR F +GE+ + + D + RS+G+AF+ + E+ Sbjct: 283 KLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEA 335 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 34.3 bits (75), Expect = 0.079 Identities = 17/71 (23%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVD 437 ++++ D+F +G ++ + + + R F F+ F PE++ ++A G H + + +V Sbjct: 169 EEDVSDYFSTFGPVQDVRIPYQ----QKRMFGFVTFMYPETVKSILAKGNPHFVCHSRVL 224 Query: 438 PKKAKARHGKI 470 K K + GK+ Sbjct: 225 VKPYKEK-GKV 234 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 34.3 bits (75), Expect = 0.079 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 371 TD L F + V D TGRSRGF F+ F+ Sbjct: 156 TDATLYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 389 TT+++L + F GEI+ I + D NT GF F++F + E + Sbjct: 45 TTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLFYSREDTE 89 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 380 T++ L+ F A+GEI + + D RS+G+AFI F + + Sbjct: 51 TSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQD 92 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 IR +F + G +LEV + DK Q++G CF+ + Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKY 168 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T++E+R +F +G + + + D TG+ +G F+ + + D+ + A Sbjct: 132 TEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 IR +F + G +LEV + DK Q++G CF+ + Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKY 168 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T++E+R +F +G + + + D TG+ +G F+ + + D+ + A Sbjct: 132 TEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRA 180 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 +T+ E+R +F + G I ++ K P G G AFI F + + +A Sbjct: 172 STEDEIRSYFRSCGVIIKVDCKMRPEDGAFSGIAFITFDTEDGAKRALA 220 >At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing protein contains Pfam profile:PF00076 RNA recognition motif Length = 602 Score = 33.9 bits (74), Expect = 0.10 Identities = 28/126 (22%), Positives = 57/126 (45%), Gaps = 4/126 (3%) Frame = +3 Query: 93 NQLNGNAENGGGDSQDHNSAAAPGRDDDRCEXXXXXXXXXEDAMKTFCWW-AELGTTDKE 269 +Q N + G ++ +PGR + R E + + + + A+ TD++ Sbjct: 276 HQRNAHRSGAGQFGEEGYWFGSPGRHE-RDEFMGMGDKSNSASKQIYLTFPADSSFTDED 334 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKK--VDP 440 + ++FG +G ++ + + + R F F+ F E++ ++A G H I + + V P Sbjct: 335 VSNYFGNFGPVQDVRIPYQ----QKRMFGFVTFLHSETVRIILARGNPHFICDSRVLVKP 390 Query: 441 KKAKAR 458 K K R Sbjct: 391 YKEKGR 396 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLL 637 + N+F FG + +V +P+ Q++ F F+TF V +L Sbjct: 335 VSNYFGNFGPVQDVRIPY----QQKRMFGFVTFLHSETVRIIL 373 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 T + +L + F +G + + V D TG SRGF F+ F + E + + Sbjct: 224 TREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAI 271 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/60 (25%), Positives = 31/60 (51%) Frame = +3 Query: 246 ELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 425 + T+ ++ F +G++ + V D +T +SRG AF+++ + E K + + I N Sbjct: 65 DFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILN 124 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 33.9 bits (74), Expect = 0.10 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 410 TT+ +L + FG YG+I+ I V + SRGFAFI ++ +++ +AA E Sbjct: 29 TTESDLTELFGRYGDIDRITVYS------SRGFAFIYYR---HVEEAVAAKE 71 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 419 TT+ LR+ YG I+++ + TG SRG+ F+ ++ + + + H++ Sbjct: 75 TTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSL 129 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 294 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 401 G ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 419 L +F ++GEI + V TG S G+A+I K E +K + G H + Sbjct: 254 LSKYFSSFGEITRVFVPPSHGTGGSLGYAYIDLK--EGAEKALELGRHDV 301 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 258 TDKELRDHF-GAYGEIESINVKTDPNTGRSRGFAFIVF 368 TD L D F YG ++ V D TGRS+G+ F+ F Sbjct: 166 TDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRF 203 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 282 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 F +G++ V +D TGRSRGF F+ ++ +AA Sbjct: 227 FSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFES-EPVVNDLLKTPKRTKGGKEVDVKRATPK 697 F + GT+ E+ +++ +Q +GF F+T + E + K G+ + V RA P+ Sbjct: 133 FEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPR 192 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVN 628 + FSE G +++ + D+ + +GF F+ +E VN Sbjct: 223 LERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVN 262 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 282 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 458 F G +E V + +T +SRGF F+ E +K V +N +++ +A R Sbjct: 133 FEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPR 192 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 L F +G++ V D TGRSRGF F+ + +++ ++A Sbjct: 260 LEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/65 (23%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKT-PKRTKGGKEVDVKR 685 + FSE G ++E + +D+ + +GF F+T +N+ + + G+ + V Sbjct: 260 LEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNV 319 Query: 686 ATPKP 700 A +P Sbjct: 320 AEERP 324 Score = 29.1 bits (62), Expect = 3.0 Identities = 30/131 (22%), Positives = 51/131 (38%), Gaps = 2/131 (1%) Frame = +3 Query: 72 AQDITTDNQLNGNAENGGGDSQDHNSA-AAPGRDDDRCEXXXXXXXXXEDAMKTFCWWAE 248 +QD++ ++ G+A G D + + G +R E E+A K F Sbjct: 104 SQDVSEGDESEGDASEGDVSEGDESEGDVSEGAVSERAEFPEPS----EEA-KLFVGNLA 158 Query: 249 LGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA-PESIDKVMAAGEHTINN 425 + L F G +E V + T +SRGF F+ + E+ V + +N Sbjct: 159 YDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNG 218 Query: 426 KKVDPKKAKAR 458 + + KA R Sbjct: 219 RLLTVNKAAPR 229 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFES-EPVVNDLLKTPKRTKGGKEVDVKRATPK 697 F + GT+ E+ +++ +Q +GF F+T S + + K + G+ + V +A P+ Sbjct: 170 FEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPR 229 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 264 KELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 +ELR+ F +G + + + D +G+ RGFAF+ F Sbjct: 61 EELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEF 95 Score = 31.1 bits (67), Expect = 0.74 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLKT-PKRTKGGKEVDV 679 +R F FG + +V +P D Q +GF F+ F + ++ +R+ G+E+ V Sbjct: 63 LREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITV 120 >At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 380 T++ LRD F GEI + +K + G+SR FA+I F+ + Sbjct: 15 TEERLRDVFSRKGEIADVKLKR-KSDGKSRQFAYIGFRTEQ 54 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T+ ++R+ ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 371 TESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T+ ++R+ ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 371 TESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T+ ++R+ ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 371 TESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 258 TDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVF 368 TD L + F Y ++S V D NTGRS+G+ F+ F Sbjct: 214 TDVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRF 251 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESI----NVKTDPNTGRSRGFAFIVFK 371 TD L D F A+ S V D TGRSRGF F+ F+ Sbjct: 160 TDAALFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSFR 201 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 371 TD L F Y V D TGRSRGF F+ F+ Sbjct: 151 TDAMLFTCFSVYPTCSDARVMWDQKTGRSRGFGFVSFR 188 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFC--FITFESEPVVNDLLKTPKRTKGGKEVDVK 682 I F FGTI + + F +T+ G C F+ FE V + +K GG++V ++ Sbjct: 273 IEEEFKNFGTI-KPDGVFLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIE 331 Query: 683 RATPKP 700 P P Sbjct: 332 ERRPNP 337 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFC--FITFESEPVVNDLLKTPKRTKGGKEVDVK 682 I F FGTI + + F +T+ G C F+ FE V + +K GG++V ++ Sbjct: 332 IEEEFKNFGTI-KPDGVFLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIE 390 Query: 683 RATPKP 700 P P Sbjct: 391 ERRPNP 396 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/76 (26%), Positives = 37/76 (48%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 E+++K F ++ +L F + ++ +N+ D T SRG F++ + E DK Sbjct: 15 EESVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADK 74 Query: 393 VMAAGEHTINNKKVDP 440 ++ A +NKK P Sbjct: 75 LVNA----CHNKKTLP 86 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/76 (26%), Positives = 37/76 (48%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 E+++K F ++ +L F + ++ +N+ D T SRG F++ + E DK Sbjct: 15 EESVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADK 74 Query: 393 VMAAGEHTINNKKVDP 440 ++ A +NKK P Sbjct: 75 LVNA----CHNKKTLP 86 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV--MAAGEHTINNKKV 434 D+EL F ++G + S V D TG S+ F F+ + + + M G H + KK+ Sbjct: 362 DQELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYDSQAAAQNAIDMMNGRH-LGGKKL 420 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/38 (28%), Positives = 26/38 (68%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 +++ +++ F +YG I+ +++ TD T + +G+AFI + Sbjct: 149 SSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 552 Score = 31.9 bits (69), Expect = 0.42 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVD 437 D+++ +F +G ++ + + + R F F+ F PE++ V+A G H I + +V Sbjct: 273 DEDVATYFSLFGTVQDVRIPYQ----QKRMFGFVSFAHPETVKVVLARGNPHFICDSRVL 328 Query: 438 PKKAKARHGKI 470 K K + GK+ Sbjct: 329 VKPYKEK-GKV 338 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 31.9 bits (69), Expect = 0.42 Identities = 16/71 (22%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVD 437 ++++ ++F +G ++ + + + R F F+ F PE++ ++A G H + + +V Sbjct: 272 EEDVSNYFSTFGPVQDVRIPYQ----QKRMFGFVTFVYPETVKSILAKGNPHFVCDSRVL 327 Query: 438 PKKAKARHGKI 470 K K + GK+ Sbjct: 328 VKPYKEK-GKV 337 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 258 TDKELRDHF-GAYGEIESINVKTDPNTGRSRGFAFIVF 368 +D L + F G Y ++ V D NTGRS+G+ F+ F Sbjct: 225 SDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRF 262 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 31.9 bits (69), Expect = 0.42 Identities = 19/69 (27%), Positives = 36/69 (52%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 ++++RD F A+GEIESI + D + AF+ + + E +K A + N ++ Sbjct: 241 EQDIRDQFYAHGEIESIRILAD------KACAFVTYTSREGAEK---AAQELSNRLVING 291 Query: 441 KKAKARHGK 467 ++ K G+ Sbjct: 292 QRLKLTWGR 300 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 31.5 bits (68), Expect = 0.56 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 258 TDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVFKAPES 383 TD L + F A Y ++ V D TGRS+G+ F+ F A ES Sbjct: 185 TDHMLTETFKAVYSSVKGAKVVNDRTTGRSKGYGFVRF-ADES 226 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/69 (28%), Positives = 35/69 (50%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 ++++RD F A+GEIESI + + + AF+ + E +K A E N V+ Sbjct: 241 EQDIRDQFYAHGEIESIRILAE------KACAFVTYTTREGAEK---AAEELSNRLVVNG 291 Query: 441 KKAKARHGK 467 ++ K G+ Sbjct: 292 QRLKLTWGR 300 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 31.5 bits (68), Expect = 0.56 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 T + L F G++ V D +TGRSRG+ F+ + + ++ + Sbjct: 189 TSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETAL 235 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +3 Query: 237 WWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 377 WW TTD EL YG ++ + + +G+S+G+ + F P Sbjct: 243 WW----TTDAELEAELCKYGAVKEVKFFDEKASGKSKGYCQVEFYDP 285 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.1 bits (67), Expect = 0.74 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +3 Query: 300 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 452 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 T +L + F +G + +V D T SRGF F+ F + E + + Sbjct: 185 TRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 31.1 bits (67), Expect = 0.74 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 258 TDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 +D L + F Y +++ V D NTGRS+G+ F+ F K M Sbjct: 209 SDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 Score = 30.7 bits (66), Expect = 0.98 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 297 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 EI S+ V + N G S G+ F+ F++ + DKV+ Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVL 161 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 31.1 bits (67), Expect = 0.74 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 258 TDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 +D L + F Y +++ V D NTGRS+G+ F+ F K M Sbjct: 209 SDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 Score = 30.7 bits (66), Expect = 0.98 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 297 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 EI S+ V + N G S G+ F+ F++ + DKV+ Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVL 161 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 30.7 bits (66), Expect = 0.98 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 258 TDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 +D L + F Y +++ V D NTGRS+G+ F+ F K M Sbjct: 211 SDALLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 30.7 bits (66), Expect = 0.98 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 D+EL F +G++ S V D TG S+ F FI + + + + +T+N ++ Sbjct: 352 DQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAI----NTMNGCQLSG 407 Query: 441 KKAKAR 458 KK K + Sbjct: 408 KKLKVQ 413 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/76 (25%), Positives = 33/76 (43%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 E+ +K F T+ +L F + + +N+ + T RG F+ E DK Sbjct: 9 EERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADK 68 Query: 393 VMAAGEHTINNKKVDP 440 V+ ++ +NKK P Sbjct: 69 VI----NSFHNKKTLP 80 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 30.7 bits (66), Expect = 0.98 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 D+EL F +G++ S V D TG S+ F FI + + + + +T+N ++ Sbjct: 343 DQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAI----NTMNGCQLSG 398 Query: 441 KKAKAR 458 KK K + Sbjct: 399 KKLKVQ 404 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/76 (25%), Positives = 33/76 (43%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 E+ +K F T+ +L F + + +N+ + T RG F+ E DK Sbjct: 9 EERVKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADK 68 Query: 393 VMAAGEHTINNKKVDP 440 V+ ++ +NKK P Sbjct: 69 VI----NSFHNKKTLP 80 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTD 326 ++++ DHF AYGE+ESI V + Sbjct: 238 EQDIHDHFYAYGEMESIRVMAE 259 >At5g04210.1 68418.m00409 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 193 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 ++++RDHF YGEIESI + P+ G AF+ + + +K M Sbjct: 91 EQDIRDHFCPYGEIESIVI--FPHRGGGT-CAFLTYTTRLAAEKAM 133 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 + L++ FG +GE+ + + D RG ++ FKA +K + ++ ++D Sbjct: 111 EAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK----AQLYMDGAQIDG 166 Query: 441 KKAKA 455 K KA Sbjct: 167 KVVKA 171 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP 440 + L++ FG +GE+ + + D RG ++ FKA +K + ++ ++D Sbjct: 111 EAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK----AQLYMDGAQIDG 166 Query: 441 KKAKA 455 K KA Sbjct: 167 KVVKA 171 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 29.9 bits (64), Expect = 1.7 Identities = 21/82 (25%), Positives = 32/82 (39%) Frame = +3 Query: 213 EDAMKTFCWWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 392 E+ + FC D L F + V D TG+++G+ F+ F P Sbjct: 134 ENDYRLFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSFLNPAD--- 190 Query: 393 VMAAGEHTINNKKVDPKKAKAR 458 +AA +N K V + K R Sbjct: 191 -LAAALKEMNGKYVGNRPIKLR 211 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 237 WWAELGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 WW TTD E+ YG ++ I + +G+S+G+ + F Sbjct: 211 WW----TTDAEIESVLSQYGRVKEIKFFDERVSGKSKGYCQVEF 250 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITFES-EPVVNDLLKTPKRTKGGKEVDVKRATPK 697 FS+FG ++ + D + + +GF FI FES + +L R G K + V+R TPK Sbjct: 37 FSDFGKVIRSVLAKD-FRGESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQR-TPK 94 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 336 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 G SRGFAFI F++ +S + M + + +K+ Sbjct: 54 GESRGFAFIEFESADSAGRAMLHMDGRLIGQKI 86 >At4g17720.1 68417.m02646 RNA recognition motif (RRM)-containing protein Length = 313 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +3 Query: 249 LGTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 428 LG TD++L++ F G+I + ++T T R++ A++ FK + + + TI + Sbjct: 13 LGATDRDLKEFFSFSGDI--LYLETQSETERTK-LAYVTFKDLQGAETAVLLSGATIVDS 69 Query: 429 KV 434 V Sbjct: 70 SV 71 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 60 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAAAPGRDDDR 179 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 57 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 149 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At5g65750.1 68418.m08274 2-oxoglutarate dehydrogenase E1 component, putative / oxoglutarate decarboxylase, putative / alpha-ketoglutaric dehydrogenase, putative similar to SP|P20967 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) {Saccharomyces cerevisiae}; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF00676: Dehydrogenase E1 component Length = 1025 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 685 TLHIDLLSTFCSFGSLKQIIYNWLRFKCDETEALSLVLC 569 TLH+ L +C+ G++ ++ N + F D E S C Sbjct: 415 TLHLSALPNYCTGGTVHIVVNNQVAFTTDPREGRSSQYC 453 >At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 309 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT 416 T ++L HF YG+I ++ ++ R FAFI ++A E + + A ++ Sbjct: 68 TRTRDLEKHFEPYGKIVNVRIR--------RNFAFIQYEAQEDATRALDASNNS 113 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT 416 T ++L HF YG+I ++ ++ R FAFI ++A E + + A ++ Sbjct: 109 TRTRDLEKHFEPYGKIVNVRIR--------RNFAFIQYEAQEDATRALDASNNS 154 >At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, gb:D86122 Length = 785 Score = 29.1 bits (62), Expect = 3.0 Identities = 20/70 (28%), Positives = 34/70 (48%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 ++++L + FG YGEI+ I + PN R F+ F S D + A +N ++ Sbjct: 234 SNRDLENIFGVYGEIKEI--RETPN---KRHHKFVEFFDVRSADAALKA----LNRTEIA 284 Query: 438 PKKAKARHGK 467 K+ K H + Sbjct: 285 GKRIKLEHSR 294 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 +R +F +FG +++ + + + KG+ FITF Sbjct: 28 LRRYFEQFGQVVDANVVSETYPGRSKGYGFITF 60 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 521 FSEFGTILEVEMPFDKTKNQRKGFCFITF 607 F FG I +V+ P D+ + + F F+TF Sbjct: 33 FIPFGDIKDVKTPLDQANQKHRSFGFVTF 61 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 258 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 377 T++EL D F A+G + S+ V P G+AF+ F+ P Sbjct: 14 TERELEDEFRAFGVVRSVWVARRP-----PGYAFLDFEDP 48 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEPVVNDLLK 640 +R F+ F +++ D+ + KGF FITFESE LK Sbjct: 87 LRQLFAPFARLIK-----DQQTQRPKGFGFITFESEDDAQKALK 125 >At5g16840.1 68418.m01973 RNA recognition motif (RRM)-containing protein predicted proteins - Arabidopsis thaliana Length = 259 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/61 (21%), Positives = 34/61 (55%) Frame = +3 Query: 252 GTTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 431 G T+ ++++ F GE+ESI+++++ ++ A++ FK + + + +I ++ Sbjct: 16 GATEHDIKEFFSFSGEVESIDIQSNEHS------AYVTFKETQGAETAVLLSGASIADQS 69 Query: 432 V 434 V Sbjct: 70 V 70 >At5g03480.1 68418.m00304 expressed protein ; expression supported by MPSS Length = 321 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 398 L HF + GEI + V TD G + AF+ + + DK + Sbjct: 133 LEKHFDSCGEIRHVYVPTDYERGVLKSVAFLRIEGEGAEDKAL 175 >At4g08750.1 68417.m01443 RNA recognition motif (RRM)-containing protein contains Pfam domain PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 461 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGF 353 L HF GEI + V +P+TG +GF Sbjct: 364 LSKHFSVCGEITRVFVPRNPSTGAIKGF 391 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 102 NGNAENGG--GDSQDHNSAAAPGRDDDR 179 +GN E G GD D++ PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T ++L HF YG+I ++ ++ R FAFI ++A E + + A Sbjct: 108 TRTRDLERHFEPYGKIVNVRIR--------RNFAFIQYEAQEDATRALDA 149 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 404 T ++L HF YG+I ++ ++ R FAFI ++A E + + A Sbjct: 108 TRTRDLERHFEPYGKIVNVRIR--------RNFAFIQYEAQEDATRALDA 149 >At4g24420.1 68417.m03501 RNA recognition motif (RRM)-containing protein RRM, RNA recognition motif Length = 87 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 L +HF + G I ++ + P T G A I ++ +KVM + +K+ Sbjct: 5 LTNHFKSCGVIAMVSFRRHPETDVVNGLATITMMGNDADEKVMLLNGSELGGRKL 59 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 D L + F ++GEI V D TG S+G+ F+ + Sbjct: 493 DDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKY 528 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 261 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 368 D L + F ++GEI V D TG S+G+ F+ + Sbjct: 493 DDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKY 528 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/54 (22%), Positives = 27/54 (50%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT 416 T + ++ HF YG++ ++ ++ R F+F+ F+ E K + A + + Sbjct: 105 TKEHDIEKHFEPYGKVTNVRIR--------RNFSFVQFETQEDATKALEATQRS 150 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 102 NGNAENGGGDSQDHNSAAAPGRDDD 176 +G AE+GGG S SA+A +DD Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDD 102 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T ++++ HF YG++ ++ ++ R FAF+ F E K + + T N+K + Sbjct: 81 TRERDMERHFEPYGKVLNVRMR--------RNFAFVQFATQEDATKAL---DSTHNSKLL 129 Query: 435 D 437 D Sbjct: 130 D 130 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +3 Query: 255 TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 434 T ++++ HF YG++ ++ ++ R FAF+ F E K + + T N+K + Sbjct: 107 TRERDMERHFEPYGKVLNVRMR--------RNFAFVQFATQEDATKAL---DSTHNSKLL 155 Query: 435 D 437 D Sbjct: 156 D 156 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEPVVNDLLKTPKRTKGGKEVDVKR 685 +R F FG++ V++P D+T KGF F+ F E N L + G+ + V Sbjct: 301 LRKVFESFGSVELVQVPRDET-GLCKGFGFVQFARLEDARNALNLNGQLEIAGRAIKVSA 359 Query: 686 AT 691 T Sbjct: 360 VT 361 >At1g73490.1 68414.m08508 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 259 Score = 27.5 bits (58), Expect = 9.1 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +3 Query: 270 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 437 L +HF + G++ I V +TG S G+AFI K + G H + +K+D Sbjct: 137 LWNHFSSCGKVYLIYVPIACSTGASVGYAFIDMK--NETKGLTLNGSH-LGGRKID 189 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 509 IRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 607 +R F +FG + ++ +P D +GF F+ F Sbjct: 52 LRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQF 84 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,963,402 Number of Sequences: 28952 Number of extensions: 291671 Number of successful extensions: 1299 Number of sequences better than 10.0: 187 Number of HSP's better than 10.0 without gapping: 1010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -