BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20577 (465 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 3.2 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 7.4 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = -3 Query: 280 VGQTA*QNTPTPQRAKYLGDPNSQDSVGTAADAAMPPVC 164 + +T QN ++ +PN DS+ A++A+ +C Sbjct: 508 LSETFTQNLSLMDESEGRQEPNMTDSLTRLANSALDNIC 546 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 20.6 bits (41), Expect = 7.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -2 Query: 287 RPCWSDRMTEHANSAKSKVFRRSKFTG 207 RPC R ++ SK+ R + TG Sbjct: 72 RPCVISRQLRVSHGCVSKILNRYQETG 98 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,835 Number of Sequences: 336 Number of extensions: 1978 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10721526 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -