Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20575
         (719 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF269088-1|AAK27326.1| 1011|Homo sapiens breast cancer antigen N...    31   3.1  

>AF269088-1|AAK27326.1| 1011|Homo sapiens breast cancer antigen
           NY-BR-1.1 protein.
          Length = 1011

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +3

Query: 60  LPDNSAESTKYLITLLIKEIHPSIGEIRKKLQVKHIEEQELIKIREV 200
           LP N  E  +  + +L ++I P   ++RKKL+VKH  EQ L +I+++
Sbjct: 861 LPLNQEEEKRRNVDILKEKIRPE-EQLRKKLEVKHQLEQTL-RIQDI 905


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,130,846
Number of Sequences: 237096
Number of extensions: 1764384
Number of successful extensions: 3058
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2889
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3058
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)