BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20575 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.3 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.3 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.3 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 22 5.1 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 422 MYFVNWIDHTFEVLSKLSEVVYKNDYK 502 +YF+ W+ + L+ L ++ DY+ Sbjct: 363 VYFITWLGYVNSALNPLIYTIFNLDYR 389 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 422 MYFVNWIDHTFEVLSKLSEVVYKNDYK 502 +YF+ W+ + L+ L ++ DY+ Sbjct: 363 VYFITWLGYVNSALNPLIYTIFNLDYR 389 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 24.2 bits (50), Expect = 1.3 Identities = 7/27 (25%), Positives = 15/27 (55%) Frame = +2 Query: 422 MYFVNWIDHTFEVLSKLSEVVYKNDYK 502 +YF+ W+ + L+ L ++ DY+ Sbjct: 363 VYFITWLGYVNSALNPLIYTIFNLDYR 389 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 187 LINSCSSMCLTCNFFRISPILGCISLIKSV 98 LI CS++ T +I+ I CI+ K++ Sbjct: 100 LITECSAISDTNVHLKITKIFQCITKFKTI 129 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,432 Number of Sequences: 438 Number of extensions: 4089 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -