BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20574 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 36 0.044 SB_46725| Best HMM Match : Extensin_2 (HMM E-Value=1.9) 34 0.14 SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) 32 0.41 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) 31 1.3 SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) 31 1.3 SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_44967| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) 31 1.3 SB_51971| Best HMM Match : rve (HMM E-Value=7.7e-31) 31 1.3 SB_48315| Best HMM Match : GASA (HMM E-Value=1.8) 31 1.3 SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) 31 1.3 SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) 31 1.3 SB_27499| Best HMM Match : RVT_1 (HMM E-Value=9.2e-39) 31 1.3 SB_25381| Best HMM Match : ETF (HMM E-Value=9.9) 31 1.3 SB_15323| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) 31 1.3 SB_46152| Best HMM Match : DUF241 (HMM E-Value=0.62) 30 1.7 SB_36954| Best HMM Match : PH (HMM E-Value=1.2e-22) 30 1.7 SB_42301| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) 30 2.2 SB_21873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) 29 2.9 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_30685| Best HMM Match : RRM_1 (HMM E-Value=2e-07) 29 5.1 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_37298| Best HMM Match : rve (HMM E-Value=2.7e-29) 28 6.7 SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_16707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 28 8.9 SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) 28 8.9 SB_41898| Best HMM Match : EGF_CA (HMM E-Value=3.9e-14) 28 8.9 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 28 8.9 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 28 8.9 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 35.5 bits (78), Expect = 0.044 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +1 Query: 571 PKTPPLQKKPTSPRKIIEPVPPTPN-RSAETVELLPQFELKLPKRPARDRV 720 P++PP P P P+PPTPN + T ELLP+ ++ P A DRV Sbjct: 1308 PESPPPPPPPPPPPPP-PPLPPTPNVEDSGTHELLPKNDVVHPMHNADDRV 1357 >SB_46725| Best HMM Match : Extensin_2 (HMM E-Value=1.9) Length = 496 Score = 33.9 bits (74), Expect = 0.14 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +1 Query: 556 VSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAETVELLPQFELKLPKRPARDRVS 723 ++ S P+T P P SP + P+PPTP+ S+E+ LP K P +P R R S Sbjct: 137 LTSSDPQTRPAMPLP-SPSRSEMPLPPTPSSSSES---LPS-GTKSPTKPLRSRSS 187 >SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) Length = 687 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 553 EVSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAETVE 666 E +PK PP ++ P +P+ EP PP P+ SA+T + Sbjct: 4 EAEPLVPKAPP-EQPPPAPK---EPKPPKPDTSADTAQ 37 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 505 DEADELMNDFADEVFQEVSQSIPKTPPLQKKPTSPRKIIEPVPPTPN 645 D+ D+ +D D+ + + SIP TPP + P P + P PP PN Sbjct: 759 DDDDDDDDDDDDDDDDDDNNSIPTTPP-PEYPPPPPGLARPNPPPPN 804 >SB_57258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 129 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 160 >SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) Length = 1311 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 1111 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 1142 >SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39) Length = 1510 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 1195 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 1226 >SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1413 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 1217 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 1248 >SB_44967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1284 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 1220 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 1251 >SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38) Length = 1425 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 594 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 625 >SB_51971| Best HMM Match : rve (HMM E-Value=7.7e-31) Length = 488 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 424 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 455 >SB_48315| Best HMM Match : GASA (HMM E-Value=1.8) Length = 340 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 129 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 160 >SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37) Length = 1122 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 1075 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 1106 >SB_28983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 887 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 918 >SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39) Length = 1750 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 1234 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 1265 >SB_27499| Best HMM Match : RVT_1 (HMM E-Value=9.2e-39) Length = 872 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 594 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 625 >SB_25381| Best HMM Match : ETF (HMM E-Value=9.9) Length = 528 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 357 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 388 >SB_15323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 43 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 74 >SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05) Length = 717 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 653 LPSTPVVSSKPILPEPEVTPLPEVSPKSSETV 684 >SB_46152| Best HMM Match : DUF241 (HMM E-Value=0.62) Length = 1110 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = +2 Query: 380 ANRDEQIKEINEIEVKIQGLK---QKLVEQLDSMSDDDEDFLNIRTK 511 A +E +KEI +E +++GL+ QK+ E + S SD + FL +T+ Sbjct: 205 ALENESMKEIKGLEERLEGLQQLLQKVQELVQSQSDMAQGFLQNQTR 251 >SB_36954| Best HMM Match : PH (HMM E-Value=1.2e-22) Length = 501 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 580 PPLQKKPTSPRKIIEPVPPTPNRSAETVELLP 675 PP KKP+SP+ + + VPP S + ++ P Sbjct: 164 PPRTKKPSSPQDLYDIVPPPRPESDDIYDIAP 195 >SB_42301| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) Length = 600 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +1 Query: 532 FADEVFQEVSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAETVEL 669 F + +E P P + P SP+ + P PP+P R A EL Sbjct: 491 FVHPLVEEAKSRDPVATPPPRSPRSPKVTMSP-PPSPGRHATVDEL 535 >SB_21873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 550 QEVSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAETVELLPQ 678 Q +Q +TP ++ P+ R+ P P TP R A TV+ PQ Sbjct: 500 QLATQQRQQTPATRQAPSPSRR--PPQPTTPRREAPTVQPRPQ 540 >SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) Length = 553 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P TP + KP P + P+P +S+ETV Sbjct: 489 LPCTPVVSSKPILPEPEVTPLPEVSPKSSETV 520 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 14 QKES*RKRNS*ERNQESSQEKEKQTSRYNKTKYTSIAD 127 +KE RKR + E+ +E+EK Y + ++ S+AD Sbjct: 227 EKEEERKRQVEQLKLEAKKEREKMFQEYQEQEWASLAD 264 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 526 NDFADEVFQEVSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAE 657 N D+ +EV + IP PP P P +I+ PP P R E Sbjct: 348 NGANDDSGEEVDRDIPTPPPPPHSPPPPLPVIQLNPP-PARPLE 390 >SB_30685| Best HMM Match : RRM_1 (HMM E-Value=2e-07) Length = 349 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = +2 Query: 425 KIQGLKQKLVEQLDSMSDD 481 K+ L+QK+V+Q++SMSDD Sbjct: 15 KLSPLEQKIVKQIESMSDD 33 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 386 RDEQIKEINEIEVKIQGLKQKLVEQLDSMSDDDEDFLNIRTKLMS 520 +D+ KE+N E I+ L L + ++D DE+ N R +L S Sbjct: 188 QDDCEKEVNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELES 232 >SB_51224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 808 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 401 KEINEIEVKIQGLKQKLVEQLDSMSDDDEDFLNIRTKL 514 +E N +EV++ L+ +LV S DED +N +TKL Sbjct: 602 EERNSLEVEVSRLRSELVS---SKLKADEDLMNAKTKL 636 >SB_37298| Best HMM Match : rve (HMM E-Value=2.7e-29) Length = 350 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 568 IPKTPPLQKKPTSPRKIIEPVPPTPNRSAETV 663 +P P + KP P + P+P +S+ETV Sbjct: 286 LPSIPVVSSKPILPEPEVTPLPEVSPKSSETV 317 >SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 538 DEVFQEVSQSIPKTPPLQKKPTSPRK 615 DEVF SQS+P P + +PT+P++ Sbjct: 335 DEVFDSQSQSLPMAPTV--RPTAPQR 358 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 547 FQEVSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAETVELLP 675 F + P P +Q P + R+ P+PP P R+ + LP Sbjct: 542 FDDTPTRAPPPPDMQTNPDTERRP-PPLPPAPKRALDLKPNLP 583 >SB_16707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = +1 Query: 511 ADELMNDFADEVFQEVSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAETVELLPQFELK 690 ADE M+DFAD+ E +++ PK QK + I P+ + + P+ +L+ Sbjct: 15 ADETMDDFADDGAPERARNTPKN---QKSDDYKKAISVKAAEHPDDAPAITKTSPERDLR 71 Query: 691 LPKRPA 708 P+ Sbjct: 72 SDDSPS 77 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 389 DEQIKEINEIEVKIQGLKQKLVEQLDSMSDDDED 490 +EQ++ ++ + K+Q +L Q D++ DD ED Sbjct: 533 NEQVEGLSAEKEKLQAANNELQRQRDNLEDDKED 566 >SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) Length = 599 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +2 Query: 5 KKIQKES*RKRNS*ERNQESSQEKEKQTSRYNKTKYTSIADEHGKEFRAINN*CLCWPD 181 K+ +K+ +K ER +E +EK+K+ + K + + K+F N L W + Sbjct: 41 KERRKKERKKERKKERKKERKKEKKKERKKERKEERKKERKKAEKKFTDSNESVLVWTE 99 >SB_41898| Best HMM Match : EGF_CA (HMM E-Value=3.9e-14) Length = 1087 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 614 FRGDVGFFCSGGVFGMDC 561 F GD GF CSG V+ MDC Sbjct: 270 FNGD-GFTCSGKVYRMDC 286 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/73 (23%), Positives = 35/73 (47%) Frame = +2 Query: 5 KKIQKES*RKRNS*ERNQESSQEKEKQTSRYNKTKYTSIADEHGKEFRAINN*CLCWPDT 184 ++++K S + S E+EK+T+R ++ + + G + L + Sbjct: 80 RRVKKRSLSRTTGYSCYCHSPGEEEKETARQDRESRAESSKDEGSKRNTKQGTGL--ENA 137 Query: 185 KKPRCINRTTKPG 223 +KPR +NR ++PG Sbjct: 138 EKPRIVNRYSEPG 150 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/73 (23%), Positives = 35/73 (47%) Frame = +2 Query: 5 KKIQKES*RKRNS*ERNQESSQEKEKQTSRYNKTKYTSIADEHGKEFRAINN*CLCWPDT 184 ++++K S + S E+EK+T+R ++ + + G + L + Sbjct: 80 RRVKKRSLSRTTGYSCYCHSPGEEEKETARQDRESRAESSKDEGSKRNTKQGTGL--ENA 137 Query: 185 KKPRCINRTTKPG 223 +KPR +NR ++PG Sbjct: 138 EKPRIVNRYSEPG 150 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,921,525 Number of Sequences: 59808 Number of extensions: 318484 Number of successful extensions: 1726 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1716 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -