BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20574 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.2 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 3.9 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 9.0 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 9.0 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.0 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 553 EVSQSIPKTPPLQKKPTSPRKIIEPVPPTPNRSAETVELLP 675 + +QS P +PP+ K ++ E +PP P + + +P Sbjct: 613 DTNQSCP-SPPVTTKRDGTQETEERLPPLPPKRIRKMPSMP 652 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +3 Query: 117 PLLMNMEKNSEPSITDVFAGQILKNHGVLIE 209 P+++ + K +P+I + L HG++IE Sbjct: 247 PIIVAINKIDKPNIDIIKVQYELAKHGIVIE 277 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 93 DIIRPNIPPLLMNMEKNSE 149 +I+RP+ +LM ++KN + Sbjct: 264 NIVRPDFINMLMELQKNPQ 282 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +1 Query: 583 PLQKKPTSPRKIIEPVPPTPNRSAETVELLP 675 P K P P + +P+P P +LP Sbjct: 66 PFAKPPIGPLRFRKPLPIEPWHGVLNATVLP 96 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +1 Query: 583 PLQKKPTSPRKIIEPVPPTPNRSAETVELLP 675 P K P P + +P+P P +LP Sbjct: 66 PFAKPPIGPLRFRKPLPIEPWHGVLNATVLP 96 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,807 Number of Sequences: 438 Number of extensions: 2973 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -