BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20573 (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0139 - 2074193-2077146,2077549-2078043,2078983-2079190 46 1e-05 03_05_0887 - 28527602-28530555,28531296-28531790,28532377-28532584 46 1e-05 03_05_0886 - 28516210-28519163,28519577-28520071,28520757-28520964 46 1e-05 03_05_0969 + 29283905-29284570,29284862-29284930,29286533-292866... 44 9e-05 06_01_0320 - 2320317-2320336,2320791-2320902,2321092-2321236,232... 42 2e-04 02_02_0017 - 6131265-6131284,6131654-6131774,6132011-6132146,613... 40 0.001 04_04_1592 - 34649484-34649547,34650118-34650186,34650325-346504... 38 0.003 07_03_0971 + 23038409-23039134,23040321-23040611 38 0.004 02_02_0498 - 10973243-10973345,10973850-10973882,10974104-109741... 38 0.004 10_08_0491 - 18283404-18283482,18283590-18283658,18283767-182838... 38 0.006 03_02_1033 + 13550955-13551700,13552837-13553290,13553451-135536... 37 0.008 03_02_1031 + 13541327-13542072,13543209-13543662,13543823-135440... 37 0.008 11_01_0699 - 5757410-5757458,5757760-5757831,5758084-5758152,575... 36 0.018 11_01_0705 - 5795976-5796051,5796450-5796518,5796632-5796780,579... 36 0.024 11_01_0702 - 5782202-5782277,5782692-5782760,5782878-5783026,578... 36 0.024 03_01_0107 + 849489-850652,850745-850835,850926-851083,851180-85... 36 0.024 01_06_0923 + 33044283-33044433,33044826-33045242,33046209-330465... 35 0.032 05_03_0376 - 13252220-13252354,13252433-13252541,13253279-132533... 34 0.055 04_04_0589 + 26449184-26450500,26452220-26452310,26452428-264525... 34 0.055 09_03_0044 - 11855569-11855664,11855775-11855891,11856572-118566... 33 0.096 02_02_0241 - 8204430-8205398 33 0.096 03_05_1112 + 30488678-30488806,30489047-30489228,30489310-304895... 33 0.17 01_06_0898 - 32832665-32832724,32832761-32832815,32832957-328331... 33 0.17 07_03_0011 + 12370624-12370684,12372573-12372718,12372793-123731... 32 0.29 12_01_0063 - 535364-536085,536226-536439,536989-537981,538238-53... 31 0.39 11_01_0559 - 4406815-4406922,4408954-4409042,4409177-4409270,440... 31 0.51 03_06_0003 + 30921197-30921388,30921514-30921632,30921742-309218... 31 0.51 10_08_0316 - 16688911-16689044,16689141-16689211,16689303-166893... 31 0.68 12_01_0503 - 3981603-3981730,3982858-3983023,3983057-3983139,398... 30 0.90 08_02_0130 - 12900202-12900277,12901457-12901536,12901654-129017... 30 0.90 05_03_0185 + 9348559-9348958,9349560-9349687,9349782-9349808,935... 30 0.90 01_03_0084 - 12286416-12286514,12286632-12286683,12286771-122868... 30 0.90 06_03_0940 + 26145746-26145879,26146740-26146821,26147349-261474... 30 1.2 05_06_0264 + 26756337-26756411,26756494-26756594,26757196-267573... 30 1.2 02_02_0016 - 6118739-6118758,6119116-6119236,6119478-6119613,611... 30 1.2 07_03_0153 - 14481421-14481506,14481933-14482111,14483046-144831... 29 1.6 04_04_0990 - 29955207-29955551,29955639-29955813,29955887-299560... 29 1.6 04_04_0835 + 28538032-28539006,28539113-28539203,28539291-285394... 29 1.6 03_01_0363 + 2827990-2828055,2828215-2829306,2829715-2829837,282... 29 1.6 11_01_0061 - 456521-457389,457534-457659,458377-459307,459564-45... 29 2.1 10_05_0068 + 8774712-8774787,8774812-8774852,8774895-8775743,877... 29 2.1 04_03_0897 - 20646750-20646918,20647927-20648038,20649650-206501... 29 2.1 02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820... 29 2.1 02_05_0076 + 25637752-25639062,25639221-25639297,25640962-256410... 29 2.1 08_01_0058 + 388989-389102,389226-389337,389457-389483,389787-38... 29 2.7 06_02_0200 - 12946139-12946282,12947636-12947842,12949506-129496... 29 2.7 03_06_0030 + 31161821-31161927,31163700-31163934,31164064-311648... 29 2.7 02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478... 29 2.7 01_01_0911 - 7176355-7176372,7176502-7176756,7177352-7177615,717... 29 2.7 01_01_0542 + 3975500-3975546,3976273-3976370,3976694-3976830,397... 29 2.7 03_05_0373 + 23581812-23583293 28 3.6 02_04_0131 - 20046033-20046505,20047140-20047233,20047343-200474... 28 3.6 05_07_0366 + 29691093-29691590 28 4.8 03_05_0700 + 26920743-26920771,26920880-26920991,26921205-269213... 28 4.8 03_02_0939 + 12571052-12571173,12571219-12571309,12571413-125715... 28 4.8 06_03_0967 - 26395537-26396590,26400918-26401111 27 6.3 04_04_1596 + 34684943-34686340,34688085-34688175,34688290-346883... 27 6.3 03_02_0614 + 9863622-9863675,9864353-9864604,9865125-9865268,986... 27 6.3 03_01_0320 - 2510907-2512190 27 6.3 02_04_0149 + 20201674-20201891,20202009-20202111,20202658-202027... 27 6.3 01_06_0303 + 28324155-28325045,28326208-28326321 27 6.3 01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902,467... 27 6.3 01_01_0590 + 4396958-4397155,4397246-4397335,4397445-4397583,439... 27 6.3 11_06_0634 - 25685216-25685329,25685407-25685511,25685681-256857... 27 8.4 11_03_0124 - 10324706-10324813,10324852-10325151 27 8.4 08_02_1201 - 25243516-25243681,25243784-25243892,25244046-252441... 27 8.4 07_01_0174 - 1227871-1228043,1228303-1228423,1228519-1228588,122... 27 8.4 01_06_0845 - 32389889-32389909,32390074-32390241,32390334-323904... 27 8.4 >09_01_0139 - 2074193-2077146,2077549-2078043,2078983-2079190 Length = 1218 Score = 46.4 bits (105), Expect = 1e-05 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 RCL TL+ H + ++ FH P+++S S DQT+++W + + C Sbjct: 84 RCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTC 127 Score = 40.3 bits (90), Expect = 8e-04 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 C+ L H+H+ FH V+S S+DQTV+VW+ Sbjct: 127 CVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD 163 Score = 30.7 bits (66), Expect = 0.68 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 19 LYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 L H FH +LP ++SG+ D+ VK+W Sbjct: 200 LEGHDRGVNWASFHPTLPLIVSGADDRQVKLW 231 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 55 FHRSLPYVISGSVDQTVKVWECR*KHCHFS 144 FH + P +SG D +KVW + C F+ Sbjct: 59 FHATQPLFVSGGDDYKIKVWNYKTHRCLFT 88 Score = 28.3 bits (60), Expect = 3.6 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 TL H + + + FH ++S S D++++VW+ Sbjct: 243 TLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVWD 276 >03_05_0887 - 28527602-28530555,28531296-28531790,28532377-28532584 Length = 1218 Score = 46.4 bits (105), Expect = 1e-05 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 RCL TL+ H + ++ FH P+++S S DQT+++W + + C Sbjct: 84 RCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIWNWQSRTC 127 Score = 40.3 bits (90), Expect = 8e-04 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 C+ L H+H+ FH V+S S+DQTV+VW+ Sbjct: 127 CVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD 163 Score = 31.5 bits (68), Expect = 0.39 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 19 LYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 L H FH +LP ++SG+ D+ VK+W Sbjct: 200 LEGHDRGVNWASFHPTLPLIVSGADDRQVKIW 231 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 55 FHRSLPYVISGSVDQTVKVWECR*KHCHFS 144 FH + P +SG D +KVW + C F+ Sbjct: 59 FHATQPLFVSGGDDYKIKVWNYKTHRCLFT 88 Score = 27.9 bits (59), Expect = 4.8 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 TL H + + + FH ++S S D+++++W+ Sbjct: 243 TLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIWD 276 >03_05_0886 - 28516210-28519163,28519577-28520071,28520757-28520964 Length = 1218 Score = 46.4 bits (105), Expect = 1e-05 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 RCL TL+ H + ++ FH P+++S S DQT+++W + + C Sbjct: 84 RCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTC 127 Score = 40.3 bits (90), Expect = 8e-04 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 C+ L H+H+ FH V+S S+DQTV+VW+ Sbjct: 127 CVAVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWD 163 Score = 30.7 bits (66), Expect = 0.68 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 19 LYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 L H FH +LP ++SG+ D+ VK+W Sbjct: 200 LEGHDRGVNWASFHPTLPLIVSGADDRQVKLW 231 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 55 FHRSLPYVISGSVDQTVKVWECR*KHCHFS 144 FH + P +SG D +KVW + C F+ Sbjct: 59 FHATQPLFVSGGDDYKIKVWNYKTHRCLFT 88 Score = 27.9 bits (59), Expect = 4.8 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 TL H + + + FH ++S S D+++++W+ Sbjct: 243 TLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRIWD 276 >03_05_0969 + 29283905-29284570,29284862-29284930,29286533-29286631, 29287016-29287324 Length = 380 Score = 43.6 bits (98), Expect = 9e-05 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 RCL+ L AH TS+DF+R ++SGS D ++W+ HC Sbjct: 146 RCLRVLPAHSEPVTSVDFNRDGAMIVSGSYDGLCRIWDSATGHC 189 Score = 38.3 bits (85), Expect = 0.003 Identities = 19/44 (43%), Positives = 25/44 (56%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 R +KTL H ++A L F + SGS D+TV+VWE R C Sbjct: 104 RLMKTLSGHTNYAFCLAFSPHGNMLASGSFDETVRVWEVRSGRC 147 >06_01_0320 - 2320317-2320336,2320791-2320902,2321092-2321236, 2321353-2321459,2321572-2321665,2321752-2321948, 2322311-2322382,2322504-2322618,2323060-2323176, 2323253-2323344,2323445-2323621,2323746-2323820, 2323911-2324051,2324671-2324859,2325298-2325363, 2325445-2325595,2325718-2325786,2326293-2326441, 2326526-2326657,2326756-2327081,2327167-2327203, 2327926-2327980,2328242-2328309,2328464-2328466 Length = 902 Score = 42.3 bits (95), Expect = 2e-04 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C++TL H H +++ FH LP +I+GS D TV++W Sbjct: 216 CVQTLEGHTHNISAVCFHPELPIIITGSEDGTVRIW 251 Score = 33.9 bits (74), Expect = 0.073 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 +K AH + + H +LPYV+S S D +K+W+ Sbjct: 87 VKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWD 122 Score = 32.3 bits (70), Expect = 0.22 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRS--LPYVISGSVDQTVKVWECR*KHC 135 TL H +D+ PY+I+GS D T KVW+ + K C Sbjct: 175 TLDGHQKGVNCVDYFTGGDRPYLITGSDDSTAKVWDYQTKSC 216 >02_02_0017 - 6131265-6131284,6131654-6131774,6132011-6132146, 6132423-6132529,6133006-6133099,6133199-6133395, 6134401-6134472,6135128-6135304,6135393-6135467, 6135557-6135697,6136439-6136627,6136969-6137034, 6137118-6137268,6137596-6137664,6138751-6138899, 6138969-6139100,6139198-6139523,6139599-6139635, 6139765-6139803,6140196-6140250,6140363-6140424, 6140512-6140532,6140820-6140822 Length = 812 Score = 39.9 bits (89), Expect = 0.001 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C++TL H H +++ FH LP ++GS D TV++W Sbjct: 234 CVQTLEGHAHNVSAVCFHPELPITLTGSEDGTVRLW 269 Score = 33.9 bits (74), Expect = 0.073 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRS--LPYVISGSVDQTVKVWECR*KHC 135 TL H +D+ PY+I+GS DQT KVW+ + K C Sbjct: 193 TLDGHSKGVNCVDYFTGGDRPYLITGSDDQTAKVWDYQTKSC 234 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 +K AH + + H + P+V+S S D +K+W+ Sbjct: 105 VKVFEAHTDYIRCVAVHPTQPFVLSSSDDMLIKLWD 140 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFH-RSLPYVISGSVDQTVKVW 114 C + H H+ + F+ + S S+D+TVKVW Sbjct: 147 CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTVKVW 183 >04_04_1592 - 34649484-34649547,34650118-34650186,34650325-34650444, 34650630-34650742,34650824-34650898,34651224-34651346, 34651427-34651446,34652354-34652410,34652922-34653860, 34653961-34654189,34654296-34654439,34654527-34654601, 34655363-34655433,34656103-34656205,34656407-34656633, 34656791-34656908,34657239-34657369,34657709-34657802 Length = 923 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 + ++TL H S+DFH + SGS+D +K+W+ R K C Sbjct: 114 KIVRTLTGHRSNCMSVDFHPFGEFFASGSLDTNLKIWDIRRKGC 157 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 C+ T H ++ F +V+SG D VK+W+ Sbjct: 157 CIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWD 193 >07_03_0971 + 23038409-23039134,23040321-23040611 Length = 338 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFSNLN--SPMISLSL 177 RC++ + AH TS+ F R ++SGS D T K+W+ C + ++ P +S S+ Sbjct: 166 RCVRAIDAHSEPVTSVHFIRDGSIIVSGSHDGTCKIWDAGTGSCLKTVIDEKKPAVSFSM 225 Query: 178 Y 180 + Sbjct: 226 F 226 >02_02_0498 - 10973243-10973345,10973850-10973882,10974104-10974166, 10975934-10976004,10976703-10976789,10976870-10976983, 10977395-10977508,10977784-10977844,10978608-10978923, 10979031-10979721,10979948-10980073,10980180-10980247, 10980314-10980449,10981109-10981238,10981266-10981382, 10981614-10981763,10982158-10982266,10982584-10982701, 10984143-10984168,10984219-10984256,10986267-10986373 Length = 925 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 9/72 (12%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVI-SGSVDQTVKVWECR*KHC----HFSNLNSPMIS 168 +CLK L H + +H LP ++ SGS+DQ V++W+ + C F N++ ++ Sbjct: 251 KCLKVLSGHRRTPWVVRYHPLLPDILASGSLDQEVRLWDAKTSDCIGSQDFRNISKQILM 310 Query: 169 ----LSLYFHVR 192 S+ FH R Sbjct: 311 NRPIASIAFHAR 322 >10_08_0491 - 18283404-18283482,18283590-18283658,18283767-18283883, 18283953-18284068,18284149-18284223,18284248-18284430, 18284530-18284591,18284668-18285606,18285723-18285846, 18285917-18286060,18286151-18286225,18286359-18286382, 18287025-18287095,18287305-18287407,18287555-18287781, 18287910-18288027,18288220-18288311,18288793-18288874 Length = 899 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 + ++T H SLDFH + SGS D +K+W+ R K C Sbjct: 97 KVVRTFTGHRSSCASLDFHPFGEFFASGSSDTNMKIWDMRKKGC 140 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE-CR*KHCH-FSNLNSPMISLSLY 180 C+ T H L F +++SG D +VK+W+ K H F N P+ L + Sbjct: 140 CIHTYKGHTRRIDVLRFTPDGRWIVSGGSDNSVKIWDLTAGKLLHDFRNHEGPINCLDFH 199 Query: 181 FH 186 H Sbjct: 200 PH 201 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 49 LDFHRSLPYVISGSVDQTVKVWE 117 LDFH + +GS D+TVK W+ Sbjct: 196 LDFHPHEFLLATGSADKTVKFWD 218 >03_02_1033 + 13550955-13551700,13552837-13553290,13553451-13553648, 13553726-13553807,13554496-13554590 Length = 524 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 +K+L AH TSLD +++ S D+T+K+W CR Sbjct: 476 IKSLVAHESKVTSLDISGDGQQIVTVSHDRTIKIWSCR 513 >03_02_1031 + 13541327-13542072,13543209-13543662,13543823-13544020, 13544098-13544179,13544868-13544962 Length = 524 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 +K+L AH TSLD +++ S D+T+K+W CR Sbjct: 476 IKSLVAHESKVTSLDISGDGQQIVTVSHDRTIKIWSCR 513 >11_01_0699 - 5757410-5757458,5757760-5757831,5758084-5758152, 5758329-5758477,5758568-5758699,5758784-5759109, 5759330-5759399,5759684-5759738,5760322-5760377, 5760500-5760700,5761466-5761651,5761756-5761906, 5761978-5762206,5762321-5762582,5762858-5762959 Length = 702 Score = 35.9 bits (79), Expect = 0.018 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +1 Query: 16 TLYAHHHFATSLDFHR--SLPYVISGSVDQTVKVWECR*KHC 135 TL+ H + D+ + Y+I+GS+D+T ++W+C+ + C Sbjct: 558 TLFGHGSAVSCFDYFTRGNQQYIITGSLDKTARIWDCKSRTC 599 Score = 33.9 bits (74), Expect = 0.073 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C++ L H T + H LP +++GS D+TV++W Sbjct: 599 CVQILIGHMDCVTCVCSHPDLPILLTGSNDETVRLW 634 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 +K AH T LD H + PYV+S + +K+W+ Sbjct: 471 VKRFKAHSWNITCLDVHPTEPYVLSVGLLDPIKMWD 506 >11_01_0705 - 5795976-5796051,5796450-5796518,5796632-5796780, 5796875-5797006,5797128-5797450,5798166-5798172, 5799126-5799180,5799685-5799740,5799862-5800029, 5800912-5801097,5801269-5801419,5801515-5801743, 5802277-5802532,5802793-5802894 Length = 652 Score = 35.5 bits (78), Expect = 0.024 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C++TL H T + H LP +++GS D+TV++W Sbjct: 564 CVQTLEGHTDCITCVCSHPDLPILLTGSNDETVRLW 599 Score = 35.1 bits (77), Expect = 0.032 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +1 Query: 16 TLYAHHHFATSLDFHR--SLPYVISGSVDQTVKVWECR*KHC 135 TL H + + LD+ + Y+I+GS D+T K+W+C+ + C Sbjct: 523 TLSGHGYIVSCLDYFTRGNQLYMITGSWDKTAKIWDCQRRTC 564 Score = 30.3 bits (65), Expect = 0.90 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVIS-GSVDQTVKVWE 117 +K AH T+LD H + PY++S GS DQ +K+W+ Sbjct: 437 VKRFKAHVWNITTLDVHPTEPYLLSIGSQDQ-IKLWD 472 >11_01_0702 - 5782202-5782277,5782692-5782760,5782878-5783026, 5783119-5783250,5783343-5783671,5784166-5784172 Length = 253 Score = 35.5 bits (78), Expect = 0.024 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C++TL H T + H LP +++GS D+TV++W Sbjct: 165 CVQTLEGHTDCITCVCSHPDLPILLTGSNDETVRLW 200 Score = 32.3 bits (70), Expect = 0.22 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +1 Query: 16 TLYAHHHFATSLDFHR--SLPYVISGSVDQTVKVWECR*KHC 135 TL H DF + Y+I+GS D+T K+W+C+ + C Sbjct: 124 TLSGHVSIVDCFDFFTRGNQLYMITGSWDKTAKIWDCQRRTC 165 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = +1 Query: 43 TSLDFHRSLPYVIS-GSVDQTVKVWE 117 T+LD H + PY++S GS DQ +K+W+ Sbjct: 49 TTLDVHPTEPYLLSVGSQDQ-IKLWD 73 >03_01_0107 + 849489-850652,850745-850835,850926-851083,851180-851231, 852373-852452,852540-852633,852711-853231,854087-854202, 854242-854293 Length = 775 Score = 35.5 bits (78), Expect = 0.024 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFH-RSLPYVISGSVDQTVKVWECR 123 CLK +++H ++ T + FH S Y ISG +D V++W+ R Sbjct: 409 CLK-VFSHTNYVTCVQFHPTSDNYFISGCIDGLVRIWDVR 447 >01_06_0923 + 33044283-33044433,33044826-33045242,33046209-33046538, 33046806-33046876,33047283-33047357,33047435-33047578, 33047645-33047816,33047933-33048616,33048711-33048767, 33048850-33048956,33049485-33049610,33050221-33050295, 33050387-33050499,33050789-33050905,33051384-33051444, 33051690-33051763,33052267-33052388,33052472-33052620, 33053525-33053635,33053946-33054008,33054689-33054722, 33055253-33055375,33055971-33056033,33056130-33056196, 33056311-33056356,33056446-33056552,33056923-33056971, 33057208-33057273,33057544-33057630 Length = 1286 Score = 35.1 bits (77), Expect = 0.032 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 + +++L H TS++FH + SGS D +K+W+ + K C Sbjct: 189 KVVRSLTGHRSSCTSVEFHPFGEFFASGSSDTDLKIWDIKKKGC 232 >05_03_0376 - 13252220-13252354,13252433-13252541,13253279-13253337, 13253608-13253700,13254078-13254153,13254405-13254467, 13254535-13254629,13254743-13254845,13254930-13255024, 13255098-13255156,13255445-13255656,13256090-13256222, 13256691-13257081 Length = 540 Score = 34.3 bits (75), Expect = 0.055 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKV 111 L+TL AH TS+D+H +LP I+GS D +V+V Sbjct: 504 LRTL-AHSASITSVDWHPTLPMYITGSADNSVRV 536 >04_04_0589 + 26449184-26450500,26452220-26452310,26452428-26452585, 26452670-26452768,26453296-26453345,26453654-26453705, 26453773-26454058,26454286-26454400,26454938-26455020, 26455381-26455466 Length = 778 Score = 34.3 bits (75), Expect = 0.055 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +1 Query: 1 TRCLKTLYAHHHFATSLDFHR-SLPYVISGSVDQTVKVW 114 T CLKT ++H + T + F+ Y ISGS+D+ V++W Sbjct: 458 TSCLKT-FSHSDYVTCIQFNPVDDRYFISGSLDEKVRIW 495 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +KT H L + +S Y++S S+D+TVK+W C Sbjct: 420 VKTFEGHSEDVLDLCWSKS-QYLLSSSMDKTVKLWHMSRTSC 460 >09_03_0044 - 11855569-11855664,11855775-11855891,11856572-11856682, 11856768-11856874,11857182-11857221,11857328-11857408, 11857578-11857631,11857800-11857860,11857984-11858029, 11858276-11858352,11858448-11858563,11858654-11858890 Length = 380 Score = 33.5 bits (73), Expect = 0.096 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +C T H + S+ + V++GS D T ++W+CR C Sbjct: 201 KCKMTFKGHTDYLHSIAVREANRQVVTGSEDGTARIWDCRSGKC 244 >02_02_0241 - 8204430-8205398 Length = 322 Score = 33.5 bits (73), Expect = 0.096 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 25 AHHHFATSLDFHRSLPYVIS-GSVDQTVKVWECR 123 AH H SLD+ + P +++ GSVD++++VW+ R Sbjct: 195 AHDHEVLSLDWDKYDPSILATGSVDKSIRVWDVR 228 >03_05_1112 + 30488678-30488806,30489047-30489228,30489310-30489505, 30490095-30491117 Length = 509 Score = 32.7 bits (71), Expect = 0.17 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C T+ AH S+ F + +ISG DQTVK+W Sbjct: 220 CRITIRAHDGGCGSIIFQHNTDKLISGGQDQTVKIW 255 >01_06_0898 - 32832665-32832724,32832761-32832815,32832957-32833135, 32833218-32833328,32833600-32833647,32833810-32833949, 32834402-32834539,32834660-32834804,32834936-32835002, 32835226-32835329,32835444-32835647 Length = 416 Score = 32.7 bits (71), Expect = 0.17 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L+ L H T DF + Y+ S S+D+T++VWE Sbjct: 208 LQKLIGHSKDITDFDFSSNNQYIASCSMDKTMRVWE 243 >07_03_0011 + 12370624-12370684,12372573-12372718,12372793-12373129, 12374323-12374452,12375346-12375406,12375572-12375618, 12376873-12376950,12377195-12377345,12377495-12377558, 12377735-12377893,12378007-12378128,12378952-12378981, 12379050-12379124,12379563-12379644,12379809-12379938, 12381417-12382164,12382833-12383054,12383127-12383276, 12384851-12384904,12384985-12385058,12386130-12386204, 12386365-12386584 Length = 1071 Score = 31.9 bits (69), Expect = 0.29 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +TL+ H SL +++ +++SGSVD+T VW+ + C Sbjct: 363 QTLFKHKGPIFSLKWNKKGDFLLSGSVDKTAIVWDTKTWEC 403 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 R L +L H S+ F Y+ SGS+DQ + +W + Sbjct: 990 RLLYSLAGHRQPVYSVAFSPGGEYLASGSLDQCLHIWSVK 1029 >12_01_0063 - 535364-536085,536226-536439,536989-537981,538238-538255, 538601-538860,539950-540073,540978-541310,541447-541531, 541683-541768,541843-541941,542041-542180,542717-543043, 543163-543774,543887-543971,543972-544067,544147-544500, 544536-544559,544597-544707,544811-544894,545468-545546, 546122-546279,546412-546528,546622-546780,546857-546939, 547525-547627,549184-549495 Length = 1925 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 T+ AH T+L HR P + SGS Q +KV+ Sbjct: 1062 TIEAHRGSLTALAVHRHAPVIASGSAKQMIKVF 1094 >11_01_0559 - 4406815-4406922,4408954-4409042,4409177-4409270, 4409344-4409481,4409570-4409727,4409826-4409916, 4410003-4411637 Length = 770 Score = 31.1 bits (67), Expect = 0.51 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHR-SLPYVISGSVDQTVKVW 114 CLK L+ H+ + T + F+ Y ISGS+D V++W Sbjct: 566 CLK-LFPHNDYVTCVQFNPVDDGYFISGSLDSKVRIW 601 >03_06_0003 + 30921197-30921388,30921514-30921632,30921742-30921811, 30922078-30922161,30922258-30922344,30922431-30922501, 30922648-30922702,30923374-30923509,30925009-30925103, 30925203-30925357,30925435-30925543,30925761-30925817, 30925913-30926027,30926177-30926264,30926738-30927501, 30927600-30927688,30928315-30928422,30928550-30928657, 30928887-30928977,30929235-30929287,30929557-30929712, 30930763-30930825,30931491-30931535,30932075-30932130, 30933051-30933132,30933238-30933354,30933428-30933530, 30933912-30934062,30934180-30934417,30934564-30934764, 30934850-30934935,30935036-30935135 Length = 1347 Score = 31.1 bits (67), Expect = 0.51 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 ++T Y H LDFH P +IS + D T++ ++ Sbjct: 176 IRTFYDHTQPINDLDFHPESPILISAAKDNTIRFFD 211 >10_08_0316 - 16688911-16689044,16689141-16689211,16689303-16689354, 16689589-16689685,16689764-16689841,16689938-16690054, 16690172-16690276,16691026-16691100,16691297-16691356, 16691454-16691549,16691838-16691954,16692142-16692260, 16692349-16692490,16694204-16694290,16694852-16694914, 16695081-16695161 Length = 497 Score = 30.7 bits (66), Expect = 0.68 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L TL H TSL F ++GS D+TVK+W+ Sbjct: 226 LCTLTGHSKKITSLKFVPRDELFVTGSADKTVKIWQ 261 >12_01_0503 - 3981603-3981730,3982858-3983023,3983057-3983139, 3983250-3983301,3983497-3983654,3983756-3985617, 3986029-3986093,3986176-3986340,3986836-3986893, 3987479-3987590,3987661-3987712,3988080-3988140, 3988220-3988377,3988705-3988787,3988897-3988945, 3989122-3989185,3990225-3990317,3990410-3990543, 3991364-3991585,3991815-3991937,3992103-3992267, 3993064-3993450 Length = 1479 Score = 30.3 bits (65), Expect = 0.90 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLP-YVISGSVDQTVKVW 114 CLK ++AH+ + T + F+ + + ISGS+D V++W Sbjct: 1275 CLK-VFAHNDYVTCIQFNPADDRFFISGSLDAKVRLW 1310 >08_02_0130 - 12900202-12900277,12901457-12901536,12901654-12901740, 12902475-12902636,12904766-12904855,12904959-12905078, 12905671-12905798,12905873-12906272 Length = 380 Score = 30.3 bits (65), Expect = 0.90 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L T H+ S D R +I+GS DQT K+W+ Sbjct: 45 LGTYRGHNGAVWSCDVSRDSTRLITGSADQTAKLWD 80 >05_03_0185 + 9348559-9348958,9349560-9349687,9349782-9349808, 9350250-9350369,9350474-9350563,9351206-9351292, 9351410-9351489,9352843-9352918 Length = 335 Score = 30.3 bits (65), Expect = 0.90 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L T H+ S D R +I+GS DQT K+W+ Sbjct: 45 LGTYSGHNGAVWSCDVSRDSTRLITGSADQTAKLWD 80 >01_03_0084 - 12286416-12286514,12286632-12286683,12286771-12286871, 12287498-12287650,12287703-12287762,12287872-12287998, 12288581-12288708,12289196-12289291,12289473-12289526, 12289603-12289689,12290954-12291057,12291163-12291246, 12291374-12291422,12291523-12291886,12292186-12292226 Length = 532 Score = 30.3 bits (65), Expect = 0.90 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 28 HHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 H S+DF R + SGS D +KVW R C Sbjct: 267 HDDAVLSVDFSRDSEMLASGSQDGKIKVWRIRTGQC 302 Score = 27.9 bits (59), Expect = 4.8 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 + LK H+ + F VI+ S D TVKVW+ + C Sbjct: 344 KMLKEFRGHNSYVNCAIFSTDGSRVITASSDCTVKVWDTKTTDC 387 >06_03_0940 + 26145746-26145879,26146740-26146821,26147349-26147427, 26147527-26147624,26148392-26148479,26148589-26148686, 26148881-26148982,26149237-26149281,26150535-26150574, 26150988-26151074,26151254-26151330,26151746-26151808, 26152650-26152766,26152905-26153116,26153690-26153785, 26153869-26153935,26154028-26154081 Length = 512 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC--HFSNLNSPMISLSL 177 L+ + H + +H + Y+ +GS D+TV++W+ + C F S ++SL++ Sbjct: 359 LRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQTGECIRMFIGHRSMVLSLAM 416 >05_06_0264 + 26756337-26756411,26756494-26756594,26757196-26757369, 26757449-26757548,26757869-26758006,26758104-26758185, 26758631-26758680,26758748-26758873 Length = 281 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 RCL+ H SL +SGS+D +V++W+ R C Sbjct: 106 RCLRYFKGHKDRVVSLCMSPVNDSFMSGSLDHSVRIWDLRVNAC 149 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 RC +L + + AT F YVISGS D T+ W Sbjct: 197 RCGFSLESSPNVATEAAFTPDGQYVISGSGDGTLHAW 233 >02_02_0016 - 6118739-6118758,6119116-6119236,6119478-6119613, 6119887-6119993,6120316-6120409,6120509-6120705, 6121872-6121943,6122597-6122773,6122862-6122936, 6123027-6123167,6123837-6124025,6124415-6124480, 6124564-6124714,6125040-6125200,6126279-6126410, 6126508-6126833,6126906-6126942,6127056-6127088, 6127500-6127554,6127666-6127753,6127817-6127862 Length = 807 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 +K AH + + H + P+V+S S D +K+W+ Sbjct: 119 VKVFEAHTDYIRCVAVHPTQPFVLSSSDDMLIKLWD 154 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFH-RSLPYVISGSVDQTVKVW 114 C + H H+ + F+ + S S+D+TVKVW Sbjct: 161 CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTVKVW 197 >07_03_0153 - 14481421-14481506,14481933-14482111,14483046-14483130, 14483301-14483499,14484222-14484292,14484380-14484486, 14484571-14484703,14484870-14485020,14485147-14485249, 14485330-14485438,14485587-14485746,14486293-14486394, 14486892-14487009,14487596-14487750,14487850-14487948, 14488078-14488167 Length = 648 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 1 TRCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 TR KTL H T++ FHR P S S D T V+ Sbjct: 554 TRPYKTLKNHSKDITNVTFHRKYPLFASSSEDCTAYVF 591 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 C H+ SL + ++ SGS D T++VWE C Sbjct: 337 CYLEFKGHNGPVKSLSVEATGQWIASGSSDGTIRVWEVETGRC 379 >04_04_0990 - 29955207-29955551,29955639-29955813,29955887-29956017, 29956317-29956436,29956908-29956984,29957070-29957316, 29957413-29957569,29958191-29958309,29958421-29958555, 29958636-29958921,29959009-29959211,29959732-29959881, 29960084-29960266,29960931-29961278 Length = 891 Score = 29.5 bits (63), Expect = 1.6 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 8/62 (12%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVI--SGSVDQTVKVWECR*KHC------HFSNLNSPM 162 C H T++ FH+ ++ SGS D TV+VW K C HFS + S Sbjct: 153 CTHFFRGHAGVVTTVMFHKDPKRLLLFSGSEDATVRVWNLESKKCVAVLKEHFSAVTSLA 212 Query: 163 IS 168 +S Sbjct: 213 LS 214 >04_04_0835 + 28538032-28539006,28539113-28539203,28539291-28539448, 28539543-28539594,28539707-28539786,28539890-28539983, 28540078-28540633,28541160-28541259,28541576-28541617, 28542445-28542588 Length = 763 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/38 (34%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYV-ISGSVDQTVKVWE 117 C++ +Y H +F T + F+ + + ISGS+D ++VW+ Sbjct: 346 CIR-VYPHSNFVTCVQFNLADENLFISGSIDGKIRVWD 382 >03_01_0363 + 2827990-2828055,2828215-2829306,2829715-2829837, 2829994-2830110,2830248-2830429,2830558-2830744, 2830846-2831055,2831177-2831305,2832179-2832247, 2832751-2832873,2832957-2833007,2833101-2833250 Length = 832 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFS 144 TLY H +D +++GS D+ +K+W CH S Sbjct: 478 TLYGHKLPVLCMDISSDGVLIVTGSADKNLKIWGMDFGDCHKS 520 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 CL+ + H S+D S +++SGS DQ ++V+ R Sbjct: 54 CLQIVGGHRSEIWSIDVDPSERFLVSGSADQELRVFTVR 92 >11_01_0061 - 456521-457389,457534-457659,458377-459307,459564-459581, 459924-460183,461834-461918,462587-462919,463053-463137, 463289-463374,463455-463556,463656-463795,464332-464658, 464778-465389,465502-465586,465587-465682,465762-466115, 466212-466322,466426-466509,467086-467164,467742-467899, 468034-468150,468240-468398,468475-468557,469098-469200, 470784-471080 Length = 1899 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 T+ AH +L HR P + SGS Q +KV+ Sbjct: 1050 TIEAHRGSLMALAVHRHAPVIASGSAKQMIKVF 1082 >10_05_0068 + 8774712-8774787,8774812-8774852,8774895-8775743, 8776210-8776582,8776814-8777484 Length = 669 Score = 29.1 bits (62), Expect = 2.1 Identities = 20/48 (41%), Positives = 24/48 (50%) Frame = +1 Query: 34 HFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFSNLNSPMISLSL 177 HF+ S DF I GSVD KVW R H +F L S + S+ L Sbjct: 127 HFSLS-DFCNKSVNHICGSVDDEAKVWHSRLCHINF-GLMSRLSSMCL 172 >04_03_0897 - 20646750-20646918,20647927-20648038,20649650-20650108, 20650237-20650330,20650449-20650525,20650637-20650688, 20650770-20650927,20651191-20651281,20651465-20652529 Length = 758 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 19 LYAHHHFATSLDFHR-SLPYVISGSVDQTVKVWE 117 L+ H + T + F+ Y ISGS+D V+VW+ Sbjct: 379 LFKHKDYVTCVQFNPIDERYFISGSIDGKVRVWD 412 >02_05_0300 + 27681204-27681656,27681745-27681840,27681933-27682022, 27682126-27682227,27682310-27682456,27683608-27683748, 27683749-27683808,27685133-27685230,27685308-27685410, 27685954-27686037 Length = 457 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 L L H T + + SGS D TV++W+C+ C Sbjct: 143 LTPLQGHEKVVTGIALPAGSDKLYSGSKDGTVRMWDCQTGQC 184 >02_05_0076 + 25637752-25639062,25639221-25639297,25640962-25641095, 25641178-25641242,25641431-25641482,25641912-25641994, 25642128-25642221,25642332-25642861 Length = 781 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 49 LDFHRSLPYVISGSVDQTVKVWECR*KHC 135 L F S+ Y++S S+D+TV++W +C Sbjct: 470 LHFSISVQYLLSSSMDKTVRLWHVSSTYC 498 >08_01_0058 + 388989-389102,389226-389337,389457-389483,389787-389859, 389958-390061,390144-390358,390429-390528,390739-390805, 391628-391716,391810-391948,392057-392157,392921-393088, 393302-393510 Length = 505 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 KTL HH L + + +++S SVD + VW+ Sbjct: 106 KTLLFHHKDVLDLQWSQDGAFLVSASVDNSCIVWD 140 >06_02_0200 - 12946139-12946282,12947636-12947842,12949506-12949629, 12950167-12950369,12950922-12951620,12951723-12951784, 12952395-12952404,12954905-12957631 Length = 1391 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 1 TRCLKTLYAHHHFAT--SLDFHRSLPYVISGSVDQTVKVWE 117 T + L AHH A S F+R L ISGS D T++VW+ Sbjct: 516 TGAILCLAAHHMHAQPDSRTFNRVL---ISGSFDSTIRVWD 553 >03_06_0030 + 31161821-31161927,31163700-31163934,31164064-31164826, 31165816-31167650,31169294-31169424,31169993-31170075, 31170426-31170680,31171125-31171220,31171695-31171775, 31171811-31171968,31172434-31172534,31172614-31172629, 31173390-31173439,31174558-31174588,31175156-31175305, 31176135-31176173,31176288-31176410,31176496-31176552, 31176837-31176911,31177003-31177107 Length = 1496 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/57 (22%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCH---FSNLNSPMISLSL 177 T+ HH + ++F + V++ ++D+ + W+ + ++ + NL+S + SLS+ Sbjct: 1034 TIGQHHEVVSCIEFSQITGQVVTATLDKKLMFWDSQTRNVNPNSIKNLDSDVASLSV 1090 >02_05_0890 - 32546918-32547088,32547224-32547334,32547705-32547884, 32547960-32548064,32548333-32548431,32548524-32548679, 32548772-32548850,32549213-32549278,32549382-32549536, 32549675-32550034,32550150-32550305,32550779-32550856, 32551471-32551812 Length = 685 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 28 HHHFATSLDFHRSLP-YVISGSVDQTVKVW 114 H A S+DF R+ P ++SGS D VKVW Sbjct: 472 HEKRAWSVDFSRTEPSMLVSGSDDCKVKVW 501 >01_01_0911 - 7176355-7176372,7176502-7176756,7177352-7177615, 7177691-7177810,7177910-7178041,7178136-7178252, 7178335-7178459,7178611-7178920,7179368-7179550, 7179643-7179787,7180126-7181355,7181454-7181563, 7181768-7182037,7182130-7182963 Length = 1370 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 28 HHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 H TSL S + SGS+D+T++VW+ R Sbjct: 1126 HTKAITSLAVLHSEEKLFSGSLDRTIRVWQLR 1157 >01_01_0542 + 3975500-3975546,3976273-3976370,3976694-3976830, 3977518-3977871,3977953-3978041,3978502-3978589, 3978659-3978734,3978858-3978907,3979032-3979340, 3979803-3979982,3980086-3980325,3980471-3980582, 3980931-3981040,3981162-3981311,3981777-3981932, 3982289-3982405,3982759-3982839,3983338-3983478 Length = 844 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 19 LYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L H T + F S+P + + S D+TV+VW+ Sbjct: 645 LEEHSLLITDVRFSPSIPRLATSSFDKTVRVWD 677 >03_05_0373 + 23581812-23583293 Length = 493 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 1 TRCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 +RCL+++ AH ++ V +GS D TVKVW Sbjct: 254 SRCLESVCAHDDAINTVAAAGFDGVVFTGSADGTVKVW 291 >02_04_0131 - 20046033-20046505,20047140-20047233,20047343-20047434, 20047560-20047611,20047721-20047878,20048190-20048280, 20048397-20049455 Length = 672 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHR-SLPYVISGSVDQTVKVWE 117 CL ++ H + T + F+ Y ISGS+D V+VW+ Sbjct: 374 CL-AVFRHGDYVTCVQFNPVDERYFISGSIDGKVRVWD 410 >05_07_0366 + 29691093-29691590 Length = 165 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 85 PISRMASFCGNRGWWRSGDAHRG 17 P RMA C R WWR AHRG Sbjct: 68 PGKRMAFRCRER-WWRRRPAHRG 89 >03_05_0700 + 26920743-26920771,26920880-26920991,26921205-26921306, 26921391-26921503,26921858-26921927,26922348-26922425, 26922500-26922616,26922738-26922832,26923080-26923159, 26923405-26923532 Length = 307 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 25 AHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +H ++ FH ++ SGS D TV++W+ R C Sbjct: 87 SHTSNVMAVGFHCDGNWMYSGSEDGTVRIWDLRTATC 123 >03_02_0939 + 12571052-12571173,12571219-12571309,12571413-12571512, 12571726-12571807,12571897-12571953,12572632-12572713, 12572792-12572884,12573984-12574047,12574161-12574246, 12574329-12574430,12574526-12574609,12574885-12574945, 12575010-12575091,12575173-12575250,12575867-12575931, 12576108-12576185,12576278-12576450 Length = 499 Score = 27.9 bits (59), Expect = 4.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 + + H + S+ F S + +GS D+T+K+W+ Sbjct: 178 RVISGHLGWVRSIAFDPSNEWFCTGSADRTIKIWD 212 >06_03_0967 - 26395537-26396590,26400918-26401111 Length = 415 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLP-YVISGSVDQTVKVWECR 123 +K + H F S R P V+SGS D T K+W+ R Sbjct: 203 VKKMAEHSSFVNSCCPARKWPPLVVSGSDDGTAKLWDLR 241 >04_04_1596 + 34684943-34686340,34688085-34688175,34688290-34688354, 34688530-34688581,34688747-34688829,34688942-34689035, 34689468-34690051 Length = 788 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 34 HFATSLDFHRSLP-YVISGSVDQTVKVWECR*KHC 135 H A LD S Y++S S+D+TVK+W+ C Sbjct: 453 HAADVLDLSWSKSQYLLSSSMDKTVKLWDITTSTC 487 >03_02_0614 + 9863622-9863675,9864353-9864604,9865125-9865268, 9865350-9866024,9866117-9866317,9866446-9866646 Length = 508 Score = 27.5 bits (58), Expect = 6.3 Identities = 8/35 (22%), Positives = 19/35 (54%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 L+ ++ ++ H P++ + +D+TVK+W Sbjct: 325 LRMMHGDKSVVNCIEPHPHFPFLATSGIDKTVKIW 359 >03_01_0320 - 2510907-2512190 Length = 427 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +1 Query: 19 LYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 L H T + SGS+D TV+ W+C C Sbjct: 127 LKGHAKAVTGFALPEGSDKLFSGSLDSTVRAWDCSTGQC 165 >02_04_0149 + 20201674-20201891,20202009-20202111,20202658-20202765, 20202882-20202991,20203170-20203277,20203667-20203733, 20204044-20204078,20204456-20204501,20204692-20204844 Length = 315 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 R ++ H+ S+ F+ V+S D+TV+ ++CR Sbjct: 96 RVIRKFRGHNSEINSVKFNEFNTVVVSAGYDRTVRAFDCR 135 >01_06_0303 + 28324155-28325045,28326208-28326321 Length = 334 Score = 27.5 bits (58), Expect = 6.3 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 70 PYVISGSVDQTVKVW 114 P ++SGS D+TVKVW Sbjct: 180 PTIVSGSWDRTVKVW 194 >01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902, 4675953-4676072,4676185-4676313,4676394-4676442, 4676899-4676970,4677574-4677707,4677798-4677915, 4678332-4678541,4678630-4678942,4679539-4679632, 4679854-4679962,4680243-4680514,4680597-4680724, 4680832-4681066,4681570-4681758,4681845-4682128, 4682218-4682398,4682486-4682728,4682904-4682986, 4683119-4683227,4687996-4688091,4688675-4688764, 4688881-4689129,4689233-4689412,4690179-4690250, 4691385-4691474,4691605-4691705,4691794-4691959 Length = 1757 Score = 27.5 bits (58), Expect = 6.3 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 64 SLPYVISGSVDQTVKVWECR*KHC 135 S+ + SGS+D+T+KVW+ + C Sbjct: 1541 SVTRLYSGSLDKTIKVWDLKTLQC 1564 >01_01_0590 + 4396958-4397155,4397246-4397335,4397445-4397583, 4398125-4398243,4398492-4398559,4399409-4399457, 4399713-4400732 Length = 560 Score = 27.5 bits (58), Expect = 6.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 L T+ H T++ F R + + VD+ VK+W+ R Sbjct: 300 LVTMLCHSGPVTAIAFDRGGHLMATAGVDRKVKIWDLR 337 >11_06_0634 - 25685216-25685329,25685407-25685511,25685681-25685740, 25685827-25685965,25686056-25686240,25686328-25686411, 25686499-25686621,25687088-25687267,25687364-25687433, 25687520-25687616,25687695-25687770,25688259-25688348, 25688383-25688529,25688647-25688715,25689004-25689177, 25689266-25689336,25689409-25689557,25690723-25690774, 25690865-25691120,25691196-25691287,25691420-25691541, 25691909-25692679,25692883-25692940,25693068-25693107, 25694462-25694595,25694685-25694793,25694896-25694991 Length = 1220 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 120 TLPNFDGLI-YAARYHVWQASVEIEAGGEVVMRIEGLE 10 T N D ++ YA YH+ VEI G++V+ E L+ Sbjct: 833 TNENVDKIVGYAVSYHLKHNKVEISKDGKLVLASESLK 870 >11_03_0124 - 10324706-10324813,10324852-10325151 Length = 135 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 117 LPNFDGLIYAARYHVWQASVEIEAGGEVV 31 +P+F G A +YH W+ +VE + +V Sbjct: 105 IPSFSGYYDAEKYHDWEMTVEQKFSAHLV 133 >08_02_1201 - 25243516-25243681,25243784-25243892,25244046-25244148, 25244273-25244304,25244405-25244625,25244948-25245063, 25245149-25245404,25245916-25246003,25246133-25246210, 25246541-25246659,25246893-25246942,25247117-25247245 Length = 488 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -1 Query: 477 YVIGYRELTLYTLRKQEQADNYLGSYCNGMCES 379 Y G REL LYT RK D Y+ NG E+ Sbjct: 372 YAPGLRELLLYTKRKYNDPDIYIAE--NGTDEA 402 >07_01_0174 - 1227871-1228043,1228303-1228423,1228519-1228588, 1228877-1228953,1229215-1229393,1229558-1229684, 1229849-1229861,1230351-1230378,1230426-1230516, 1230870-1230956,1231239-1231276,1231426-1231464, 1231553-1231699,1231899-1231958,1232033-1232111, 1232429-1232517,1232906-1232967,1233238-1233427, 1233929-1234068,1235813-1236147,1237086-1237133 Length = 730 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L + H S+D H S ++SGS D++ K+W+ Sbjct: 140 LLEMIGHTSLVYSVDAHSS-GVIVSGSEDRSAKIWK 174 >01_06_0845 - 32389889-32389909,32390074-32390241,32390334-32390453, 32390982-32391068,32391149-32391217,32391448-32391510, 32391648-32391989,32392245-32392337,32392457-32392660, 32392910-32393154,32393249-32393414 Length = 525 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 438 RKQEQADNYLGSYCNGMCESMPKI*TDYKFNLSR 337 +K ++ADN +GS C S P + D ++ +++ Sbjct: 393 KKHQEADNNIGSPCQDDSSSQPHLAHDLRWEMNK 426 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,690,591 Number of Sequences: 37544 Number of extensions: 235838 Number of successful extensions: 755 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -