BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20573 (498 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32323| Best HMM Match : WD40 (HMM E-Value=0) 43 2e-04 SB_13408| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 39 0.003 SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_57108| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) 36 0.025 SB_37154| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) 36 0.025 SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.043 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.075 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 33 0.099 SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_42943| Best HMM Match : WD40 (HMM E-Value=0) 31 0.40 SB_36541| Best HMM Match : WD40 (HMM E-Value=0) 31 0.40 SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.40 SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21) 31 0.40 SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.40 SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23) 31 0.70 SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) 29 1.6 SB_40185| Best HMM Match : WD40 (HMM E-Value=0) 29 1.6 SB_31688| Best HMM Match : WD40 (HMM E-Value=3.3e-10) 29 1.6 SB_42895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_23517| Best HMM Match : WD40 (HMM E-Value=0) 29 2.1 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 28 3.7 SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_46758| Best HMM Match : WD40 (HMM E-Value=5.8e-13) 28 4.9 SB_25576| Best HMM Match : WD40 (HMM E-Value=1.6e-30) 28 4.9 SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_48750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_20870| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_6741| Best HMM Match : WD40 (HMM E-Value=0) 27 6.5 SB_40103| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) 27 6.5 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_50716| Best HMM Match : WD40 (HMM E-Value=0) 27 8.6 SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36) 27 8.6 SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) 27 8.6 >SB_32323| Best HMM Match : WD40 (HMM E-Value=0) Length = 611 Score = 42.7 bits (96), Expect = 2e-04 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 RCL TL H + + FH P+++S S DQT+++W + + C Sbjct: 84 RCLFTLLGHLDYIRTTFFHHEYPWILSSSDDQTIRIWNWQSRTC 127 Score = 41.5 bits (93), Expect = 4e-04 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 C+ L H+H+ FH S V+S S+DQTV+VW+ Sbjct: 127 CICVLTGHNHYVMCAQFHPSEDMVVSASLDQTVRVWD 163 Score = 33.9 bits (74), Expect = 0.075 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 49 LDFHRSLPYVISGSVDQTVKVWECR*KHCHFSNLNSPMISLSLYFH 186 ++FH P +SG D +KVW + K C F+ L + +FH Sbjct: 57 INFHTVQPLFVSGGDDYKIKVWNYKQKRCLFTLLGHLDYIRTTFFH 102 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 19 LYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 L H + FH ++P ++SG+ D+ VK+W Sbjct: 203 LEGHDRGVNWVAFHPTMPLIVSGADDRQVKLW 234 >SB_13408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 ++TLY H T+L+FH P +ISGS D TVK+++ Sbjct: 19 IRTLYDHAEEVTALEFHPCAPVLISGSKDCTVKLFD 54 >SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) Length = 1066 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C++TL H + + FH LP +++GS D TV+VW Sbjct: 119 CVQTLEGHAQNISCVGFHPELPIILTGSEDGTVRVW 154 Score = 31.1 bits (67), Expect = 0.53 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 25 AHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 AH + S+ H PYV++ S D +K+W+ Sbjct: 13 AHSDYLRSIAVHPQQPYVLTSSDDMLIKLWD 43 Score = 30.3 bits (65), Expect = 0.92 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 70 PYVISGSVDQTVKVWECR*KHC 135 PY+ISG+ D+ VK+W+ + K C Sbjct: 98 PYLISGADDRLVKIWDYQNKTC 119 >SB_34371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 644 Score = 36.3 bits (80), Expect = 0.014 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 C+ TLY H +D H + V+SGS D T++VW+ +C Sbjct: 391 CMHTLYGHTSTVRCMDMHEEV--VVSGSRDGTLRVWDTTTGNC 431 Score = 35.1 bits (77), Expect = 0.032 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +C+ TL H + SL F + Y++SGS+D +++VW C Sbjct: 470 QCIHTLQGHTNRVYSLQFDGT--YIVSGSLDTSIRVWHAETGQC 511 Score = 33.1 bits (72), Expect = 0.13 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +CL TL H + ++ + ++SG+ D TVK+W+ C Sbjct: 510 QCLHTLVGHQSLTSGMELRNNT--LVSGNADSTVKIWDITTGQC 551 Score = 31.5 bits (68), Expect = 0.40 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +CL+TL H S + ++SGS D+T+KVW +C Sbjct: 350 KCLRTLTGHTGGVWSSQLSGHI--IVSGSTDRTLKVWNAETGYC 391 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +1 Query: 4 RCLKTLYA---HHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 +CL+TL H T L F S +VI+ S D TVK+W+ Sbjct: 550 QCLQTLAGPNKHQSAVTCLQF--SSKFVITSSDDGTVKIWD 588 >SB_57108| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) Length = 243 Score = 35.5 bits (78), Expect = 0.025 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 CL TL HH T L+ VISGS+D +K W+ Sbjct: 202 CLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWD 238 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 76 VISGSVDQTVKVWECR*KHC 135 V+SGS D+T+KVW+ + +C Sbjct: 97 VVSGSYDKTLKVWDIKTGNC 116 >SB_37154| Best HMM Match : WD40 (HMM E-Value=7.00649e-45) Length = 870 Score = 35.5 bits (78), Expect = 0.025 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 CL TL HH T L+ VISGS+D +K W+ Sbjct: 829 CLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWD 865 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 76 VISGSVDQTVKVWECR*KHC 135 V+SGS D+T+KVW+ + +C Sbjct: 724 VVSGSYDKTLKVWDIKTGNC 743 >SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 34.7 bits (76), Expect = 0.043 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 C+ L H + L+F P+V+SGS D+T+K+W C Sbjct: 634 CVLVLQGHEGAVSCLEF--DAPFVLSGSADKTIKLWNVESGDC 674 Score = 30.3 bits (65), Expect = 0.92 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 L LY H + L F + ++SGS D T++VW+ R C Sbjct: 595 LHVLYGHKGCVSCLRFDENT--LVSGSHDSTIRVWDMRTWEC 634 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 33.9 bits (74), Expect = 0.075 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 1 TRCLKT-LYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFSNLNSP 159 T C+ T L H F +F S ++IS S+D T +VW H H + L P Sbjct: 1623 TECVLTALGGHDMFCQYTEFSPSGEFIISSSIDNTAQVWRFD-THRHVTTLQHP 1675 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L++L H TSL F ++ ++S ++D+ +KVW+ Sbjct: 1257 LRSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWD 1292 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 19 LYAHHHFATSLDFHRSLPYVISGSVDQTVKVWEC 120 L H + + F + SGS D+TV+VW+C Sbjct: 1454 LGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDC 1487 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 33.5 bits (73), Expect = 0.099 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 R L+ L H +SL F S P +ISG+ D+TV++W Sbjct: 1370 RLLEVLAGHEAPVSSLAFSPSHPVLISGAWDKTVRLW 1406 >SB_43456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 33.1 bits (72), Expect = 0.13 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR-*KHCHFSNLNSPMISLSL 177 R + + H TSL F + ++SGS+D+ VKV++ + K H + SP++SL++ Sbjct: 223 RLVTSFSNHQKTITSLCFDGAYKRLLSGSIDRNVKVYDLQDYKVVHSMDYPSPILSLAV 281 >SB_42943| Best HMM Match : WD40 (HMM E-Value=0) Length = 273 Score = 31.5 bits (68), Expect = 0.40 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 K+L H+HF + + + +SGS D+T+++W+ Sbjct: 94 KSLTGHNHFVSDVVMSSDGQFALSGSWDKTLRLWD 128 >SB_36541| Best HMM Match : WD40 (HMM E-Value=0) Length = 1070 Score = 31.5 bits (68), Expect = 0.40 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KH 132 + +K L AH H ++ R+ ++S S D TVKVW+ H Sbjct: 792 KLVKDLNAHTHAVMRIELLRAHNMLVSSSRDGTVKVWDVANAH 834 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 C +TL H + + + +ISGS D+ VK+W Sbjct: 496 CTQTLIGHSSWISCVAMTTDGKTIISGSNDKNVKMW 531 >SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 31.5 bits (68), Expect = 0.40 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFS 144 C+ T H H +H ++ S S+D T K+W+ + C ++ Sbjct: 237 CVLTFADHTHAVWGCTWHSKGDFLASCSMDNTSKIWDLNSERCRYT 282 Score = 27.1 bits (57), Expect = 8.6 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPY---VISGSVDQTVKVWECR 123 RC TL H S+ F LPY +++ S D+T+ +W+ R Sbjct: 278 RCRYTLRGHADSVNSIVF---LPYSNTLLTSSADKTLSLWDAR 317 >SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21) Length = 123 Score = 31.5 bits (68), Expect = 0.40 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 K+L H+HF + + + +SGS D+T+++W+ Sbjct: 57 KSLTGHNHFVSDVVMSSDGQFALSGSWDKTLRLWD 91 >SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 459 Score = 31.5 bits (68), Expect = 0.40 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 CL+ L HH ++ F Y+ SGS D+ V +W Sbjct: 325 CLQVLSKHHEPVYTISFSPDGRYLASGSFDKRVHIW 360 >SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 31.1 bits (67), Expect = 0.53 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFS 144 L+TL H SLDFH +V SGS+D +K H FS Sbjct: 145 LRTLTGHKSSIRSLDFHPFGDFVASGSLDTNLKGHTDCVNHLRFS 189 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 31.1 bits (67), Expect = 0.53 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 + LK H F + F ++IS S D T+K+W + C Sbjct: 340 KTLKEFRGHTSFVNDVIFTADAHHIISASSDGTIKIWNIKSTEC 383 >SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 31.1 bits (67), Expect = 0.53 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKV 111 C+ T Y F S++FH S + +G D TVK+ Sbjct: 104 CVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKI 138 Score = 30.3 bits (65), Expect = 0.92 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 L +L AH ++ F ++SGS D+T+K+W+ K C Sbjct: 63 LYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDC 104 >SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23) Length = 437 Score = 30.7 bits (66), Expect = 0.70 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFS 144 +LY H ++D +++GS D+ +K+W CH S Sbjct: 241 SLYGHKLPVMAMDISSDSTLIVTGSADKNIKIWGLDFGDCHKS 283 >SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 30.7 bits (66), Expect = 0.70 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 RC+ TL H L + ++ SGSVD TV +W + Sbjct: 79 RCVHTLRQHSGDVLDLAWSPDDSFLASGSVDNTVTIWNAQ 118 >SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) Length = 195 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = +1 Query: 4 RCL--KTLYAHHHFATSLDFHRSLPYVISGSVD--QTVKVWECR 123 RC+ KTL H +D+H ++SGS D Q +K+W+ R Sbjct: 144 RCMEEKTLRGHGADVKCIDWHPHKSLLVSGSKDSQQPIKLWDTR 187 >SB_40185| Best HMM Match : WD40 (HMM E-Value=0) Length = 503 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L+ H + FH + Y+ +GS D+TV++W+ Sbjct: 160 LRIFAGHVSDVNKVAFHPNCNYIATGSSDRTVRLWD 195 >SB_31688| Best HMM Match : WD40 (HMM E-Value=3.3e-10) Length = 841 Score = 29.5 bits (63), Expect = 1.6 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSL-PYVISGSVDQTVKVWECR*KHCHFSNLNSPMISLSLY 180 +CL+TL H + FH S V SG + V++W+ + C + SL Sbjct: 19 KCLRTLQGHPRTPWCIAFHPSADELVASGCLGGEVRIWDLK-GGCEMYTPPDRAVIASLA 77 Query: 181 FH 186 FH Sbjct: 78 FH 79 >SB_42895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 10 LKTLYAHHHFATSL-DFHRSLPYVISGSVDQTVKV 111 +K L H F S R + YV+SGS D T+KV Sbjct: 32 MKRLKGHTSFVNSCCPSRRGMQYVVSGSDDSTIKV 66 >SB_23517| Best HMM Match : WD40 (HMM E-Value=0) Length = 860 Score = 29.1 bits (62), Expect = 2.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 76 VISGSVDQTVKVWECR 123 +ISGS D T++ W+CR Sbjct: 671 IISGSYDSTIRCWDCR 686 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 28 HHHFATSLDFHRSLPYVISGSVDQTVKVW 114 H +A S+ + ++SGS D+TVK+W Sbjct: 759 HKGWAHSVGISKDSSKLVSGSEDETVKIW 787 >SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 + T H + L F R + S S D+TVK+W Sbjct: 149 IHTFKGHRDVISGLAFRRGSHQLFSASHDKTVKIW 183 >SB_46758| Best HMM Match : WD40 (HMM E-Value=5.8e-13) Length = 125 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 4 RCLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 + L TL+ H +D + +GS D+TV++W+ Sbjct: 10 KLLCTLFGHTGSVFCVDLDDAAKRAFTGSADRTVRIWD 47 >SB_25576| Best HMM Match : WD40 (HMM E-Value=1.6e-30) Length = 326 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +TL H L F + ++ S S D T+K+W+ + C Sbjct: 97 RTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDFQGFEC 137 >SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2051 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 L+T H SL S Y +S S D+TVK+W Sbjct: 1731 LQTFTGHSGAVRSLCIQDSEHYFLSASKDKTVKLW 1765 >SB_48750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +1 Query: 70 PYVISGSVDQTVKVWE 117 PY+ISG+ D+ VK+W+ Sbjct: 14 PYLISGADDRLVKIWD 29 >SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1845 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 C+K HH+ L+ + +GS DQTV+ + + C Sbjct: 1359 CVKVYDGHHNAVNCLEISEDRTRLFTGSNDQTVRSYNVKTAVC 1401 >SB_20870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2032 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR 123 L+TLY H H T + L +SGS D T V R Sbjct: 1860 LQTLYGHDHEVTCVVLSWELDMAVSGSRDGTCIVHTAR 1897 >SB_6741| Best HMM Match : WD40 (HMM E-Value=0) Length = 714 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 CL L H F + ++ISGS D+T +W+ Sbjct: 90 CLAVLEGHTGAVRVCRFSPNSQFLISGSADETFIIWD 126 >SB_40103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 27.5 bits (58), Expect = 6.5 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 Query: 355 VIRLYFWHRFAH 390 +IR Y+WHR+AH Sbjct: 73 IIRHYYWHRYAH 84 >SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) Length = 198 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 CL L H F + ++ISGS D+T +W+ Sbjct: 90 CLAVLEGHTGAVRVCRFSPNSQFLISGSADETFIIWD 126 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 L L H +L +++SG+ D TVK+W+ Sbjct: 741 LNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIWD 776 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 16 TLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFSN 147 TL H ++ + + +IS S D+TVK+W+ + C F N Sbjct: 785 TLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDV--ETCAFVN 826 >SB_50716| Best HMM Match : WD40 (HMM E-Value=0) Length = 494 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVW 114 + L H +DF Y++S S D+T+KVW Sbjct: 307 RVLVGHRAAVNVVDFDDK--YIVSASGDRTIKVW 338 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 ++TL H L + L V+SGS D T+++W+ Sbjct: 346 VRTLNGHRRGIACLQYRDRL--VVSGSSDNTIRLWD 379 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 7 CLKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWE 117 CL+ L H + F ++SG+ D +KVW+ Sbjct: 385 CLRVLEGHEELVRCIRFDNKR--IVSGAYDGKIKVWD 419 >SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36) Length = 885 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 61 RSLPYVISGSVDQTVKVWECR*KHC 135 RSL ++SGS D VK+W K C Sbjct: 77 RSLSVLLSGSCDGEVKLWNLPTKDC 101 >SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +1 Query: 43 TSLDFHRSLPYVISGSVDQTVKVWECR*KHCHFSNLNS 156 T++ FH ++ +G D + ++W+ R K FS S Sbjct: 86 TAVGFHEDGKWMFTGGEDSSARIWDLR-KQIDFSRTRS 122 >SB_19094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 10 LKTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 L +L H + +S+ +IS S D+++KVW+ + C Sbjct: 80 LASLKEHDNVVSSVSVDCEKSRIISASWDRSIKVWDLTSEQC 121 >SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) Length = 383 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +1 Query: 13 KTLYAHHHFATSLDFHRSLPYVISGSVDQTVKVWECR*KHC 135 +TL H + F Y+ SGS D+++++W C Sbjct: 182 RTLRGHQGAVNVVAFSLDNRYIFSGSDDKSIRIWSRESSKC 222 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,095,162 Number of Sequences: 59808 Number of extensions: 296367 Number of successful extensions: 755 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -