BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20572 (677 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.15 |sec13||COPII-coated vesicle component Sec13|Schizosa... 28 1.1 SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosa... 26 5.8 SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|ch... 26 5.8 SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|ch... 26 5.8 SPBC12C2.01c ||SPBC17F3.03c|sequence orphan|Schizosaccharomyces ... 25 7.6 SPAC3G9.14 |sak1||transcriptional repressor Sak1|Schizosaccharom... 25 7.6 SPBPB7E8.02 |||PSP1 family protein|Schizosaccharomyces pombe|chr... 25 7.6 >SPBC215.15 |sec13||COPII-coated vesicle component Sec13|Schizosaccharomyces pombe|chr 2|||Manual Length = 297 Score = 28.3 bits (60), Expect = 1.1 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 50 GWDKIQVVNYKEAQKYMDHIFVMSYDFKGAWSN--DTLGHQTALYAPSWSPKE 202 GW + + Y H+ V + G WS D HQ ++ A SW+P E Sbjct: 60 GWAHPKFGTILASASYDGHVIVWR-ETGGVWSELMDHTAHQASVNAVSWAPHE 111 >SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 25.8 bits (54), Expect = 5.8 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = -2 Query: 622 PKPIFIAFRISPLSASISQANSPPSLLFLTYFPFSITDLRHHKSP 488 PKP+F A ++ PL+ + P T FP++ T P Sbjct: 170 PKPLFSALQVYPLATIFNCVAGLPQGFESTVFPWNKTSSTFELDP 214 >SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1208 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 125 DFKGAWSNDTLGHQTALYAPSWSPK 199 DF+G++ ND QT L S+ PK Sbjct: 41 DFRGSYLNDKSSFQTPLRNGSYQPK 65 >SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 25.8 bits (54), Expect = 5.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 513 LICVIISHQIAGCRIPHVWSLSN 445 L+CV+ ++ C P VW+LS+ Sbjct: 67 LLCVLEQKHLSECVAPFVWTLSS 89 >SPBC12C2.01c ||SPBC17F3.03c|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 318 Score = 25.4 bits (53), Expect = 7.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 246 VSSQKAGCRCCYVRTW 293 VS+ GC CCY R + Sbjct: 66 VSNHNVGCSCCYFRQY 81 >SPAC3G9.14 |sak1||transcriptional repressor Sak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 766 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 616 PIFIAFRISPLSASISQANSPPSL 545 P F A + PL + +SQ+N PP L Sbjct: 266 PSFAAPQAHPLPSHLSQSNVPPQL 289 >SPBPB7E8.02 |||PSP1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 749 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 592 SPLSASISQANSPPSLLFLTYFPFSITDL 506 +P+ +S+SQAN+P + L P S+ +L Sbjct: 515 NPIVSSVSQANAPKNALHSMPSPTSLANL 543 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,070,876 Number of Sequences: 5004 Number of extensions: 67372 Number of successful extensions: 156 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -