BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20571 (716 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q49Y29 Cluster: Putative uncharacterized protein; n=1; ... 38 0.19 UniRef50_A0EGR1 Cluster: Chromosome undetermined scaffold_96, wh... 36 0.76 UniRef50_A2D8S3 Cluster: Surface antigen BspA-like; n=4; Trichom... 36 1.00 UniRef50_Q8MUN1 Cluster: Rhoptry-associated protein 3; n=2; Plas... 35 1.7 >UniRef50_Q49Y29 Cluster: Putative uncharacterized protein; n=1; Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305|Rep: Putative uncharacterized protein - Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 /DSM 20229) Length = 693 Score = 38.3 bits (85), Expect = 0.19 Identities = 23/65 (35%), Positives = 34/65 (52%) Frame = +3 Query: 351 GNYKFSGNTSTSMKL*HINYNTLKVYSIKSIGMNWMSL**TDKPYSFVRIFLRHD*SNNI 530 G +KF+G S KL +IN + + S KSI M WMSL K Y + R+ H+ Sbjct: 87 GAFKFNGE-GISRKL-YINIKSFDLSSCKSISMGWMSLVDLHKQYIYKRLVTEHNDDPGK 144 Query: 531 VICML 545 +I ++ Sbjct: 145 IIALI 149 >UniRef50_A0EGR1 Cluster: Chromosome undetermined scaffold_96, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_96, whole genome shotgun sequence - Paramecium tetraurelia Length = 494 Score = 36.3 bits (80), Expect = 0.76 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 6/92 (6%) Frame = -3 Query: 591 RNLTKMFGVTLP--EEVEAYIL---LYYSIN-HVLKKSLQMSMVYRFIIVTSSSFRYF*C 430 R +T +F + EE++ YI LYYS H L K L +S + + +S Y Sbjct: 191 RKITILFNLDCASNEEIDNYIANANLYYSYTFHQLNKELDVSPYQQTENIDLTSLYY--- 247 Query: 429 YKL*GYCNLYVKVSLTYLYFPKIYSFPSSKYH 334 K+ Y +Y++ S +YL + Y FP S H Sbjct: 248 -KVGKYIKIYLQYSQSYLEYNPFYFFPRSVQH 278 >UniRef50_A2D8S3 Cluster: Surface antigen BspA-like; n=4; Trichomonas vaginalis G3|Rep: Surface antigen BspA-like - Trichomonas vaginalis G3 Length = 1474 Score = 35.9 bits (79), Expect = 1.00 Identities = 23/60 (38%), Positives = 34/60 (56%) Frame = +3 Query: 261 GRYQVSQFLAY*SGNKNIKLFTFLCGIYSMGNYKFSGNTSTSMKL*HINYNTLKVYSIKS 440 G Y + Q+ Y N N+ + F G+YS+G Y FS NT+ L H+N+N ++SI S Sbjct: 1365 GLYSIDQYAFY---NSNVTVVNFNNGLYSIGQYAFS-NTN----LTHVNFNE-SLHSIDS 1415 >UniRef50_Q8MUN1 Cluster: Rhoptry-associated protein 3; n=2; Plasmodium falciparum|Rep: Rhoptry-associated protein 3 - Plasmodium falciparum Length = 400 Score = 35.1 bits (77), Expect = 1.7 Identities = 21/91 (23%), Positives = 40/91 (43%) Frame = -1 Query: 422 FKGIVIYMLKFH*RTCISRKFIVSHRVNTTKKCK*FNVFVSTSIRKKLRNLVPTYV*LFN 243 F + M+K H R + + V +R K K F RK L+N V Y+ L + Sbjct: 298 FSDMKAKMVKGHKRFLMEFDYAVKNRTYALPKVKGFRFLKQLFQRKNLKNFVGMYINLLS 357 Query: 242 MNN*FVTKTSCQVFSVSISCHCQGNVRQRVD 150 F+ + ++F +++C+ + + + D Sbjct: 358 TEIDFLAEDFVEMFDTTMNCYGRQHAARAAD 388 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,811,908 Number of Sequences: 1657284 Number of extensions: 11810849 Number of successful extensions: 20892 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20888 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -