BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20571 (716 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74032-5|CAA98467.1| 219|Caenorhabditis elegans Hypothetical pr... 28 5.8 Z81139-4|CAB03479.2| 358|Caenorhabditis elegans Hypothetical pr... 28 7.7 >Z74032-5|CAA98467.1| 219|Caenorhabditis elegans Hypothetical protein F35B12.6 protein. Length = 219 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 139 NCNYVNLPNIISILKFCSD 83 N NY N PN S +KFC D Sbjct: 195 NGNYNNFPNFQSCMKFCQD 213 >Z81139-4|CAB03479.2| 358|Caenorhabditis elegans Hypothetical protein W05H5.4 protein. Length = 358 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 567 VTLPEEVEAYILLYYSINHVLKKSLQMSMVYRFI 466 VTLP EA+ ++Y H KK + + ++ F+ Sbjct: 35 VTLPVYAEAFYCVFYKCKHFSKKYVVLLQIHLFL 68 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,143,665 Number of Sequences: 27780 Number of extensions: 304733 Number of successful extensions: 569 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -