BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20570 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) 127 1e-29 SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) 96 2e-20 SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) 92 4e-19 SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) 31 0.95 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_42200| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_55154| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_45140| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) 28 6.7 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 28 6.7 >SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 127 bits (306), Expect = 1e-29 Identities = 62/86 (72%), Positives = 69/86 (80%) Frame = +1 Query: 250 QRERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDV 429 Q ERNLLSVAYKNVVGA+RSSWRVISSIEQK EGSERK+Q + YR +E EL E+C V Sbjct: 17 QEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQNTETYRQTIENELNEVCETV 76 Query: 430 LGLLDKHLIPKASNPESKVFYLKMKG 507 L LL+ LIP A + ESKVFYLKMKG Sbjct: 77 LKLLESKLIPNAQSTESKVFYLKMKG 102 Score = 85.0 bits (201), Expect = 5e-17 Identities = 42/73 (57%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = +3 Query: 510 YYRYLAEVATGETRHSVVEDSQKAYQDAFEISKA--KMQPTHPIRLGLALNFSVFYYEIL 683 YYRY EVA + R VV+ + KAY +A EI++ K+ PT PIRLGLALNFSVFYYEI+ Sbjct: 104 YYRYEGEVAGADRRREVVQKAMKAYSEAQEIAEKDPKLPPTDPIRLGLALNFSVFYYEIV 163 Query: 684 NSPDKACQLAKQA 722 +AC LAK+A Sbjct: 164 EDSKQACDLAKKA 176 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/59 (55%), Positives = 46/59 (77%), Gaps = 3/59 (5%) Frame = +3 Query: 555 SVVEDSQKAYQDAFEISKA---KMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQA 722 +VVE + +AY++A E ++ K+ PT PIRLGLALNFSVF+YEI + ++AC+LAKQA Sbjct: 207 TVVEKALQAYKEAKEAAETGDGKLAPTDPIRLGLALNFSVFHYEIQENQEEACKLAKQA 265 >SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 103 bits (248), Expect = 1e-22 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +1 Query: 250 QRERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDV 429 + ERNLLSV+YKN+VG RRSSWRVISSIE+KT S + K+Y+ +EKEL+++C +V Sbjct: 119 KEERNLLSVSYKNIVGQRRSSWRVISSIEEKTAESS-SLAIVKKYKACIEKELKDLCKEV 177 Query: 430 LGLLDKHLIPKASNPESKVFYLKMKG 507 LG+L++ LIP A + E+KVFY K+KG Sbjct: 178 LGILER-LIPGAEDEENKVFYFKLKG 202 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = +2 Query: 134 MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELS 250 M V +E L+ AKL+EQ +RYD+MA MKEV+E +LS Sbjct: 80 MMVVRETLIYNAKLSEQCDRYDEMAKIMKEVSEKYPKLS 118 >SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) Length = 251 Score = 96.3 bits (229), Expect = 2e-20 Identities = 48/85 (56%), Positives = 64/85 (75%), Gaps = 3/85 (3%) Frame = +1 Query: 256 ERNLLSVAYKNVVGARRSSWRVISSIEQKTE--GSE-RKQQMAKEYRVKVEKELREICYD 426 +RNLLSVAYKNV+GARR+SWR+I+SIEQK E G + K +M + YR +E+EL+ IC + Sbjct: 41 DRNLLSVAYKNVIGARRASWRIITSIEQKEESKGEDMAKLEMIRNYRKTIEEELKTICGE 100 Query: 427 VLGLLDKHLIPKASNPESKVFYLKM 501 +L LLD LI + + ESKVFY K+ Sbjct: 101 ILSLLDDSLIKNSQSEESKVFYNKI 125 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +2 Query: 143 DKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELS 250 DKEE V AKLAEQAERYDDM +MKEV + G ELS Sbjct: 3 DKEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELS 38 >SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) Length = 248 Score = 92.3 bits (219), Expect = 4e-19 Identities = 49/87 (56%), Positives = 60/87 (68%), Gaps = 3/87 (3%) Frame = +1 Query: 256 ERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLG 435 ERNLLSVAYKNVVGARRSSWRVISS+EQK E + K+YR + EL C +VL Sbjct: 48 ERNLLSVAYKNVVGARRSSWRVISSMEQK--APEEMAALTKKYREDITNELNGKCAEVLD 105 Query: 436 LLDKHLIPKAS---NPESKVFYLKMKG 507 +L+ +L+ N E+KVFYLKM+G Sbjct: 106 ILENYLLKDGQDDINTEAKVFYLKMRG 132 Score = 91.5 bits (217), Expect = 6e-19 Identities = 42/71 (59%), Positives = 55/71 (77%) Frame = +3 Query: 510 YYRYLAEVATGETRHSVVEDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNS 689 Y+RYL EVA G++R +E S++AY+DA ++ P+HPIRLGLALNFSVFYYEI N Sbjct: 134 YHRYLVEVAEGDSRKENIEKSREAYKDA-SAKAEELSPSHPIRLGLALNFSVFYYEIENK 192 Query: 690 PDKACQLAKQA 722 P +AC+LAK+A Sbjct: 193 PPEACKLAKEA 203 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/44 (50%), Positives = 29/44 (65%) Frame = +2 Query: 122 PSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSN 253 P+ +EEL+ AK+AEQAERYDDM AM VT+ G L++ Sbjct: 3 PNFVSKCSREELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLND 46 >SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 48.4 bits (110), Expect = 6e-06 Identities = 24/63 (38%), Positives = 39/63 (61%), Gaps = 2/63 (3%) Frame = +1 Query: 250 QRERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAK--EYRVKVEKELREICY 423 + RNLLSV YKNVVG++R +WR + ++ R Q+ +Y+ K+E EL+ +C Sbjct: 225 KEHRNLLSVGYKNVVGSKRFAWRHLHHDALQSGRYIRDSQLKGIIKYKEKIEMELKTLCR 284 Query: 424 DVL 432 ++L Sbjct: 285 EIL 287 Score = 37.1 bits (82), Expect = 0.014 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +2 Query: 134 MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELS 250 M + ELVQ AKLAEQ ER++D+ MK+ E L+ Sbjct: 186 MQDSRNELVQLAKLAEQTERFEDVILYMKKAIEINPSLN 224 >SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 1053 Score = 31.1 bits (67), Expect = 0.95 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -2 Query: 246 SSTPVSVTSFIAAAMSSYRSACSANLARCTSSSLSTDI----VDDGRGL 112 +STP SV SF+ A ++S S+ L S D+ VDDGR L Sbjct: 995 TSTPWSVRSFVVAPLNSVPSSTMRTLGHVRGPSAYIDVSEFAVDDGRAL 1043 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 534 ATGETRHS-VVEDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNS 689 A GETR + D+ +A +D KA+ Q + ALN S+F++E++NS Sbjct: 4020 ALGETRRKRSLVDTPEANED-----KAQHQVPDAEKCQFALNASLFFFEVINS 4067 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 28.7 bits (61), Expect = 5.0 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +1 Query: 304 RSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASN 471 + W ++S E+ +ER++Q E +VK E++ R+ ++ + HL K SN Sbjct: 338 KHQWNLLSEDEKNKIKAERRKQKRLELKVKREEKERKRLEELKRVSFAHLGMKLSN 393 >SB_42200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 264 VPLPLLSSTPVSVTSFIAAAMSSYRSACS-ANLARCTSSSLSTDI 133 VP P+ T ++ F++ ++S YRS + N+ + ++SL D+ Sbjct: 350 VPFPVTKQTYLAYHVFLSRSLSCYRSVINYVNILKHVNNSLGADL 394 >SB_55154| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 310 MTVGHLRHSYKQLKGGSSPVAKFDAGFRHFLHRGRH 203 +TV H++H K +GG +PV F RH H G++ Sbjct: 86 VTVRHVQHIGKTNEGGDAPV-MFRVTVRHVQHIGKN 120 >SB_45140| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) Length = 868 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/42 (26%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 588 LGMLSVNPLQQNVWFLLWPL--LQGTCSNSFHFEVKHFTFWI 469 L +LS +P++ W+L W + + +FE+KH + + Sbjct: 781 LKLLSEDPIEVQYWYLEWTICKTRNIMLRDLNFEIKHIDYML 822 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 316 RVISSIEQKTEGSERKQQMAKEYRVKVEKELREIC 420 R++ IE+K E E ++ AKE + + E+E + IC Sbjct: 919 RIMKEIEEK-EKKEEAERKAKEEKEREERERKRIC 952 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +1 Query: 361 KQQMAKEYRVKVEKELREICYDVLGLLDKHLIPK 462 K++M ++Y K+EKE+ Y+++ L K ++ K Sbjct: 292 KEEMKEKYDGKIEKEMSGAIYEIISRLMKAVVGK 325 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,243,278 Number of Sequences: 59808 Number of extensions: 472036 Number of successful extensions: 1248 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -