BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20567 (415 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 28 0.036 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 24 0.78 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 4.2 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 4.2 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 4.2 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 4.2 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 4.2 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 4.2 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 21 5.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 5.5 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 20 9.6 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 28.3 bits (60), Expect = 0.036 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 269 TTTAQTYARLPFVVLQPSSAPRGPSKQKRLRQPQPSRNN 385 TT A YAR+ + ++ + P Q++ Q QPSRNN Sbjct: 1267 TTGAAVYARV--IAPTTITSSQSPGNQQQTIQTQPSRNN 1303 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 23.8 bits (49), Expect = 0.78 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 2 NNAFLVKKRNIKKPFSKEP 58 N+ L+KKRN PF K P Sbjct: 10 NSCDLLKKRNENDPFLKRP 28 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 175 LCFLVHYCESLPVRV 131 LC+ ++Y E +PV V Sbjct: 102 LCYNINYIEQIPVPV 116 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 175 LCFLVHYCESLPVRV 131 LC+ ++Y E +PV V Sbjct: 102 LCYNINYIEQIPVPV 116 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 175 LCFLVHYCESLPVRV 131 LC+ ++Y E +PV V Sbjct: 102 LCYNINYIEQIPVPV 116 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 175 LCFLVHYCESLPVRV 131 LC+ ++Y E +PV V Sbjct: 102 LCYNINYIEQIPVPV 116 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 175 LCFLVHYCESLPVRV 131 LC+ ++Y E +PV V Sbjct: 102 LCYNINYIEQIPVPV 116 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 4.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 109 LVNQAVVPEGVEVSHIVRLLAERLFDIALLHKECIV 2 L+N A + V + + L +++FDI LL C++ Sbjct: 88 LINNATINIDVTLQNDEVLDWKKIFDINLLGLTCMI 123 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.0 bits (42), Expect = 5.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 2 NNAFLVKKRNIKKPFSK 52 N+ L+KKRN PF K Sbjct: 131 NSCDLLKKRNENDPFLK 147 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 314 QPSSAPRGPSKQKRLRQPQPSR 379 Q P+ S+Q + +QPQP + Sbjct: 1512 QQQQQPQQQSQQPQQQQPQPQQ 1533 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 20.2 bits (40), Expect = 9.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 405 NLLSAYKLFRLGCGCL 358 NLL+AY F+L C+ Sbjct: 56 NLLNAYVRFKLVTDCI 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,953 Number of Sequences: 438 Number of extensions: 1964 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10503195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -