BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20566 (607 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 25 0.44 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 23 1.8 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 25.4 bits (53), Expect = 0.44 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 95 PEMGTDLHVH*SSASDYSIILDRSPAYHEGN 3 P +G +LH H S D+S+ D P +++ N Sbjct: 353 PGVGENLHNHQSFGMDFSLNEDFYPTFNQTN 383 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 23.4 bits (48), Expect = 1.8 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = +3 Query: 36 NDAVVAGGGSVDMQICAHLRSXCLQLAGKEQLSVAAVARAFEAIPRQLADN 188 N VV G S+ + ++ + +AG+ VA A E P L DN Sbjct: 35 NVEVVVGVPSIYLTYAKNILPNNISIAGQNTYKVAKGAFTGEISPAMLLDN 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,100 Number of Sequences: 438 Number of extensions: 3481 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -