BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20561 (606 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.44 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 1.0 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 2.3 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 4.1 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 9.4 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 0.44 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 376 SPAAMTLSIDSGALNTM 326 SPA ++S+DSG++NT+ Sbjct: 555 SPAIESISVDSGSINTV 571 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 94 ITTDNQLNGNAENGGGDSQDHNSAEA 171 +T+ + +N N+ NG +S +S+ A Sbjct: 532 LTSSSNVNNNSGNGNTNSSARDSSPA 557 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 88 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRK 195 Q+ N N NA N D+Q+ N ++D+R+ Sbjct: 430 QNADNQNADNQNANNQNADNQNANKQNGNRQNDNRQ 465 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 103 DNQLNGNAENGGGDSQDHNSAEAPGRDDDRK 195 DN+ NGN +N G+ Q+ N ++D+++ Sbjct: 487 DNKQNGNRQN--GNKQNDNKQNGNRQNDNKR 515 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 103 DNQLNGNAENGGGDSQDHNS 162 DN+ NGN +N ++Q+ N+ Sbjct: 512 DNKRNGNRQNDNQNNQNDNN 531 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 106 NQLNGNAENGGGDSQDHNSAEAPGRDDDRK 195 N N NA+N D+Q+ N+ A ++ +++ Sbjct: 426 NAGNQNADNQNADNQNANNQNADNQNANKQ 455 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 106 NQLNGNAENGGGDSQDHNSAEAPGRDDDR 192 N+ N N NG + + N+ R+D++ Sbjct: 508 NRQNDNKRNGNRQNDNQNNQNDNNRNDNQ 536 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 103 DNQLNGNAENGGGDSQDHNSAE 168 DNQ N N +N D+Q H+S++ Sbjct: 522 DNQNNQN-DNNRNDNQVHHSSK 542 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAE 168 NN+N + +N N N NG G S ++N+ + Sbjct: 240 NNNNNNNNNNNNNGANDNG-NGNGASNNNNNGD 271 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 189 N + A + +N N N NG D+ + N A + D Sbjct: 232 NANTNASNNNNNNNNNNNNNNGANDNGNGNGASNNNNNGD 271 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 418 KHDMGRFLSEDSAVKSQMMKSETSSVNLELFR 513 K DM S+D S K ET+ LFR Sbjct: 434 KSDMSNMQSDDGGPLSLKNKVETTHSGTSLFR 465 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +1 Query: 205 GGLSWETTDKELRD 246 GG+ WE +KE+ D Sbjct: 100 GGIFWEGLEKEVGD 113 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,237 Number of Sequences: 438 Number of extensions: 3277 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -