BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20559 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) 85 7e-17 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) 31 1.2 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 31 1.2 SB_55749| Best HMM Match : SRCR (HMM E-Value=0) 30 2.1 SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_45214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_14988| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-08) 29 4.9 SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) 29 4.9 SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) 28 6.5 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 28 8.6 SB_6496| Best HMM Match : Collagen (HMM E-Value=0) 28 8.6 SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) 28 8.6 >SB_48657| Best HMM Match : GST_C (HMM E-Value=5.8e-07) Length = 203 Score = 84.6 bits (200), Expect = 7e-17 Identities = 41/76 (53%), Positives = 51/76 (67%) Frame = +2 Query: 2 AAGVLYTYPENFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESA 181 AAG LYTYP++FRA K LIAA+YSGT ++V P F FG+ N + +FLKKFP GKVPAFE+ Sbjct: 2 AAGKLYTYPDSFRAQKILIAAEYSGTKIEV-PAFTFGKDNHTAEFLKKFPLGKVPAFETK 60 Query: 182 DGKVLLTESNAIAYYV 229 + YV Sbjct: 61 TANACTRAMPLLTTYV 76 Score = 72.5 bits (170), Expect = 3e-13 Identities = 32/71 (45%), Positives = 50/71 (70%) Frame = +1 Query: 283 WASWSDSELLPASCAWVFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERI 462 + +++D ELLPA+ WVFP G+MQ++KQ+ ++A D+ + +L+ LL +TFLV ER+ Sbjct: 75 YVNFADQELLPAAATWVFPTYGMMQYHKQSTDKAMEDVKKYMTMLNDVLLMKTFLVGERV 134 Query: 463 TLADVIVFSTL 495 TLAD+ V L Sbjct: 135 TLADIAVCCVL 145 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 32.3 bits (70), Expect = 0.40 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 7/79 (8%) Frame = +2 Query: 92 APNFVFGET---NKSEDFLKKFPAGKVPAFE---SADGKVL-LTESNAIAYYVANESLRG 250 +PN +F + +E +L F +G + E SA+G++ L +A ++++ R Sbjct: 1798 SPNKMFNTAAPQSSNEVWLTSFCSGHSLSVELAASAEGQLNGLVSQAGVASLLSSQGFRE 1857 Query: 251 GVWLPKPVSGSGHHGLTVN 307 G+W P+PVSG L ++ Sbjct: 1858 GLWKPEPVSGEAFSSLPLS 1876 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 31.1 bits (67), Expect = 0.92 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = -2 Query: 365 LLNCMIPR*GKTQAQEAGSSSLSDHDAHCQTRAWVARLLRGDFHWQRSKRWHCFQLGALF 186 LL M R + AQ AG S+ D C + R++ GD+HWQ +K + A F Sbjct: 108 LLKRMRKRARELAAQGAGEESVFDR-IRCVA---LTRIVYGDYHWQLAKAYSKLAY-AYF 162 Query: 185 H-RHFRMQALFRQETSSRSL 129 H R QAL E + +L Sbjct: 163 HLRGLAPQALKHAENARDTL 182 >SB_7437| Best HMM Match : PAS (HMM E-Value=7.2e-14) Length = 505 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +2 Query: 32 NFRAYKALIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESN 211 N +K + Q + K+ P V GE N + +KK +P GK + + + Sbjct: 105 NIGKFKMVWIDQIDESTKKLKPKMVAGEDNGFVNAIKKVSLEDIPEGNGPSGKAIREKRS 164 Query: 212 AIAYYVANESL 244 I + N+SL Sbjct: 165 IIVNDIENDSL 175 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 426 SSHTHLPC--YRENHTCRCHCLQYTAACFPH 512 S +T PC Y+ TC C C+ YT PH Sbjct: 873 SHYTPFPCPHYQGGPTCECQCMGYTPFPCPH 903 >SB_55749| Best HMM Match : SRCR (HMM E-Value=0) Length = 1224 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 628 GAAQSVSEPTTADTCGWWATVRNQR*TFISDERTLGSSTC-GKHAA 494 GA Q+ P DT G+W N + T +S+ SS C G HAA Sbjct: 563 GALQAFKTPYNTDTGGFWIDRMNCQGTQVSECSFTKSSECSGLHAA 608 >SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 331 VFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLAD 474 ++P + Q NV+R +DL + K+ L R F V E T AD Sbjct: 73 IYPNIMDEQIRTANVQRGSADLQTSAKITLKKFLPRCFSVIESTTSAD 120 >SB_45214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = +3 Query: 213 PSLTTLPMKVSAEESGYPSPCLAVGIMV*Q*TTACFLCLGLPLPWYHAIQQTEC*TC 383 PS+TT +++E G P P + G + T C L L W A+ C C Sbjct: 109 PSMTTTYGGITSEARGIPEPIVTTGSAMNDSVTGCSL---LHQMWKKAVSDNFCALC 162 >SB_14988| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-08) Length = 619 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 582 AGGRRSGTNAERLSATNGRSGLARAESMQQCTEDNDI 472 A GR G N ERL GRS +AE + +DND+ Sbjct: 48 ADGRGCGQNDERLGEKRGRS-CFKAEEHFETDKDNDV 83 >SB_51364| Best HMM Match : DUF1431 (HMM E-Value=5.9) Length = 364 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 161 LFRQETSSRSLRTCWSRQIRNSVLLSHQSRNIVRRSTLYK 42 +FR + + + S ++ N V +SHQSR IV T+ K Sbjct: 102 VFRSKQQAPNKAVGRSDEVTNEVAVSHQSRRIVESETVRK 141 >SB_52295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 264 PSPCLAVGIMV*Q*TTACFLCLGLPLPWYHAIQQ 365 PSPC A+ + +T +C LP PWY AI Q Sbjct: 1054 PSPCYAM-----RQSTKPVVCGNLPSPWYAAIYQ 1082 >SB_16159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 238 KSPRRS--LATQARVWQWASWSDSELLPASCA 327 +SP +S L T A+V+ WA W ++ SCA Sbjct: 71 ESPTKSPDLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_25676| Best HMM Match : TSP_1 (HMM E-Value=0.0055) Length = 141 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 238 KSPRRS--LATQARVWQWASWSDSELLPASCA 327 +SP +S L T A+V+ WA W ++ SCA Sbjct: 71 ESPTKSPDLTTTAQVYSWAMWEPWQMRNLSCA 102 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 349 IMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTERITLADVIV 483 +M + K +VE K DL L+ + LLTR FL+ + + D+I+ Sbjct: 194 VMSWIKHDVESRKKDLANLLEHIRFPLLTRKFLI-DTVAKEDLIM 237 >SB_6496| Best HMM Match : Collagen (HMM E-Value=0) Length = 1234 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -1 Query: 576 GRRSGTNAERLSATNGRSGLARAESMQQC-TEDNDIGKCDSLGNKEGACE 430 G+ + T G+ G R C +E+++ G+CDS ++EG C+ Sbjct: 260 GKDGSPGLKGTRGTRGKRG-ERGRKGDMCDSEESEEGECDSEESEEGECD 308 >SB_19860| Best HMM Match : GST_C (HMM E-Value=9.6e-10) Length = 260 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +1 Query: 367 QNVERAK--SDLLAALKVLDGHLLTRTFLVTERITLADVIVFSTL 495 ++VE AK +D+ L ++ HL R FLV + +T+AD V +++ Sbjct: 112 RDVEGAKIVADINKFLGFVEKHLAGRKFLVGDSVTIADFSVATSI 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,912,494 Number of Sequences: 59808 Number of extensions: 542787 Number of successful extensions: 1493 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1491 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -