BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20559 (711 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 32 0.015 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 28 0.33 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 27 0.44 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 27 0.44 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 26 1.3 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 1.8 Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. 25 3.1 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 25 3.1 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 5.4 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 7.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.5 AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase ... 23 9.5 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 32.3 bits (70), Expect = 0.015 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +2 Query: 53 LIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVA 232 L+ A++ ++ + V + +FLK P +P ADG V++ ES+AI Y+A Sbjct: 19 LLFAKWLKLELNLIELDVLKRDHYKPEFLKLNPQHYIPTLVDADGDVVVWESSAILIYLA 78 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 27.9 bits (59), Expect = 0.33 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 116 TNKSEDFLKKFPAGKVPAFESADGK--VLLTESNAIAYYV 229 + K E +L+K P GKVPA E GK V L ES ++ Y+ Sbjct: 55 SEKPEWYLEKNPLGKVPALE-IPGKEGVTLYESLVLSDYI 93 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 27.5 bits (58), Expect = 0.44 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 155 GKVPAFESADGKVLLTESNAIAYYVANESLRGGVWLP 265 GKVP DG L ES AI Y+ E G W P Sbjct: 55 GKVPCI--VDGSFRLAESVAIYRYLCREFPTDGHWYP 89 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 27.5 bits (58), Expect = 0.44 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 403 ALKVLDGHLLTRTFLVTERITLADVIVFSTL 495 AL VL+G+L+ + ITLAD + ST+ Sbjct: 134 ALAVLNGYLINNPYAAGPNITLADYSLVSTV 164 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 516 LDPSVRSSLINVQRWFLTVAHQPQVSAVVGSL 611 L PS+ S+L ++ RW + A P V G+L Sbjct: 69 LSPSLTSALESIPRWRIVQAALPHVIHCAGAL 100 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.4 bits (53), Expect = 1.8 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 254 VWLPKPVSGSGHHGLTVNYCLLPVLGSSLTLVSCNSTNRMLNVQ 385 V LPKP G C+L LG L + N NR + Q Sbjct: 550 VLLPKPGKPPGESSSYRPLCMLDALGKVLERLILNRLNRHIEQQ 593 >Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. Length = 209 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +1 Query: 403 ALKVLDGHLLTRTFLVTERITLADVIVFSTLLHA 504 A+++L+ L F+ ++T+AD+ +F+TL A Sbjct: 135 AVELLNIFLSEHEFVAGSKMTIADISLFATLATA 168 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 24.6 bits (51), Expect = 3.1 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 627 PPTYDPKKYQELAGA 671 PP Y P++YQ +AG+ Sbjct: 33 PPEYLPERYQRIAGS 47 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 254 VWLPKPVSGSGHHGLTVNYCLLPVLGSSLTLVSCNSTNRML 376 V LPKP G +G C+L LG L + N + L Sbjct: 542 VLLPKPGKPPGSNGSYRPLCMLDALGKVLEKLILNRLHNHL 582 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 192 TFPSALSNAGTFPAGNFFKKSSDLLVSPNTKFGATFTSVPEYCAAINAL 46 T P+ ++ P+ S DLL+ T T PEY ++ L Sbjct: 291 TLPNIVNFIAQLPSDELRLSSIDLLLQSLTAENGTLVQDPEYVYRLSQL 339 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 124 VRRLLEEVSCRKSACIRKCRWKSAPN*KQC 213 VR+ E + AC+RKC P +C Sbjct: 262 VRKCPEHLLKDNGACVRKCPKGKMPQNSEC 291 >AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase protein. Length = 259 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 537 SLINVQRWFLTVAH 578 S+IN QRW LT AH Sbjct: 56 SIIN-QRWILTAAH 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 794,411 Number of Sequences: 2352 Number of extensions: 17267 Number of successful extensions: 34 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -