BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20556 (693 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.6 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.8 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 4.8 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 4.8 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 6.4 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 21 8.4 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 1.6 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +3 Query: 396 VDSVLDVVRKESESCDCLQG 455 +DS+++++R ++CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 641 FQLAGELRESHCM 603 F G +RESHCM Sbjct: 68 FGCCGAIRESHCM 80 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 267 APSRQDGAGH 238 APSRQ G+GH Sbjct: 1922 APSRQTGSGH 1931 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 541 QNHEHILSSPLAQSIRHCRRTIQCDSLSSPAS*KHRRNLLHRQRG 675 Q H+ +++SPL+Q + + +L SP R+ R+RG Sbjct: 230 QQHQGVVTSPLSQQQQAAPQGAASANLPSPLY-PWMRSQFERKRG 273 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 242 GTYLPAGGFIVVY 204 GT+L +GGF +VY Sbjct: 70 GTFLGSGGFGIVY 82 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.8 bits (44), Expect = 6.4 Identities = 15/57 (26%), Positives = 21/57 (36%) Frame = +2 Query: 407 PRCSPQRIRILRLPTGLPTYTFPRWRHRVRYGHPLISKIREEYPDRIMNTYSVVPSP 577 P+ P R+ R P P P + + R HP + + E P Y P P Sbjct: 107 PQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRP 163 Score = 21.4 bits (43), Expect = 8.4 Identities = 15/60 (25%), Positives = 23/60 (38%) Frame = +2 Query: 401 LGPRCSPQRIRILRLPTGLPTYTFPRWRHRVRYGHPLISKIREEYPDRIMNTYSVVPSPK 580 L P P R+R P P P + + R HP + + E + N +P P+ Sbjct: 23 LDPPTRPARLRREAKPEAEPGNNRPIYIPQPRPPHPRLRREAEPKAEPGNNRPIYIPQPR 82 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 21.4 bits (43), Expect = 8.4 Identities = 15/60 (25%), Positives = 23/60 (38%) Frame = +2 Query: 401 LGPRCSPQRIRILRLPTGLPTYTFPRWRHRVRYGHPLISKIREEYPDRIMNTYSVVPSPK 580 L P P R+R P P P + + R HP + + E + N +P P+ Sbjct: 22 LDPPTRPTRLRREAKPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPR 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,627 Number of Sequences: 438 Number of extensions: 4129 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -