BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20555 (606 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0103 - 12383585-12384700 29 2.9 03_04_0187 - 18236041-18236643 29 2.9 09_06_0017 - 20248672-20248783,20248982-20249229,20249314-202494... 28 5.0 08_02_1475 - 27369088-27369199,27369404-27369651,27369734-273699... 28 6.6 03_02_0671 + 10315260-10315370,10315984-10316027,10316141-103162... 28 6.6 04_03_0815 - 19949584-19950111,19950210-19950632 27 8.7 >09_03_0103 - 12383585-12384700 Length = 371 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/63 (34%), Positives = 30/63 (47%) Frame = +2 Query: 209 SCPGLYCGRIELEDGCGVTVGRVREVSGQTHQVTACRALMNPLYMTGSTLALWSSCPWFC 388 SC GL C L D G V + +G++ L P+Y GS+ +SSC W C Sbjct: 106 SCNGLLC----LGDSTGA-VQLLNPTTGES------ATLPMPMYTAGSSQ--FSSCNWHC 152 Query: 389 IGF 397 +GF Sbjct: 153 LGF 155 >03_04_0187 - 18236041-18236643 Length = 200 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = -3 Query: 583 CGLCNSVYQSESAFGEHIYSETDPGEAALTMRQVFLI*PP 464 C +C + S A G H S P AAL M + PP Sbjct: 50 CSVCGKAFPSHQALGGHKASHRKPPTAALPMHVIDAPPPP 89 >09_06_0017 - 20248672-20248783,20248982-20249229,20249314-20249480, 20249916-20250079,20251275-20251555 Length = 323 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 313 MPCVDEPSLYD-WQYLGFMVLLPMVLHWFFIDMVTRGKAENGVIIQHMCAFLEVI 474 +P ++P Y +QY+ ++V ++L F + +V K +NG H C +L + Sbjct: 260 LPQTNQPPKYKAYQYVLWVVAFVLLLVGFVVSLVMLFKGKNGNDGCHWCHYLNCV 314 >08_02_1475 - 27369088-27369199,27369404-27369651,27369734-27369900, 27370386-27370621,27371340-27371620 Length = 347 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +1 Query: 313 MPCVDEPSLYD-WQYLGFMVLLPMVLHWFFIDMVTRGKAENGVIIQHMCAFLEVI 474 +P ++P Y +QY+ + V L ++L F I +V K +NG H C +L I Sbjct: 284 LPQTNQPRKYRAYQYVLWAVALFLLLVGFVIALVMLFKGKNGNDGCHWCHYLNCI 338 >03_02_0671 + 10315260-10315370,10315984-10316027,10316141-10316204, 10316278-10316392,10316504-10316571,10316917-10317014, 10317543-10317657,10318425-10318641,10319541-10319667, 10319803-10319857,10319997-10320093,10320748-10320876, 10320964-10321097,10321660-10321746,10321998-10322069, 10322320-10322359,10322535-10322779,10323587-10323764, 10323931-10324136,10324681-10324977 Length = 832 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +1 Query: 166 AQL*IVPLQNGSCKIVSRTVLWSY*TR--RWVWSDCGACPRGFRTNASSYC 312 AQ + L G+C I + VLW R RW W + PR T++ C Sbjct: 398 AQFCLHALWFGNCHIRAIAVLWIDFVREIRWCWEESERLPRMKSTSSIDLC 448 >04_03_0815 - 19949584-19950111,19950210-19950632 Length = 316 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 491 AASVPDMTSKKAHMCCMITPFSALPLVTMSMKNQCK 384 AAS + ++ AH CC TP +A V +S CK Sbjct: 236 AASAGEGDAEDAHSCCFETPAAAAD-VAVSTATSCK 270 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,951,052 Number of Sequences: 37544 Number of extensions: 366088 Number of successful extensions: 955 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -