BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20547 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 27 0.55 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 9.0 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 27.1 bits (57), Expect = 0.55 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 358 PSEETARPSPYAQHHPPQITLHTRTQKSNGTRKTKPT*QA 477 P+E +P PY + P + T++S G +P+ Q+ Sbjct: 182 PTEANFQPHPYYPKYEPDAYITASTERSRGVTGDQPSLQS 221 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.0 bits (47), Expect = 9.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 584 RSLRTSVPVKIIFR*YPM*RSRYGQYMYFS 673 RS RTSVPVK+ P+ + G Y+ F+ Sbjct: 500 RSERTSVPVKLAKGFSPL-KPENGMYLKFN 528 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,475 Number of Sequences: 2352 Number of extensions: 13648 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -