BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20541 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 26 0.44 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.4 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 23 4.1 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 7.2 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 7.2 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 7.2 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 7.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 7.2 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 9.5 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 9.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.5 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 9.5 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 25.8 bits (54), Expect = 0.44 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 484 LGRCQYHKNFHQIHRHSPFRRYRKDRVQCK*SRRKRGSHLDRVVLQ 347 L + HK+ + +HS + RK+ Q + R++ H DRV Q Sbjct: 45 LNSLRNHKSIYH-RQHSKNEQQRKEMEQMREREREQREHSDRVTSQ 89 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 608 EGDSDHLRDISGG*VAGDHCAVLGAEAV 525 + D D + D++G DH A +GA+A+ Sbjct: 42 DSDGDGIGDLNGITARMDHIADIGADAL 69 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 414 KTAFNASRVAASEEAILTEWFFSVQERLYFTL 319 +TAF ++ A E T + SV ERL L Sbjct: 12 RTAFTYEQLVALENKFKTTRYLSVCERLNLAL 43 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 271 SVSQYREQTGRATYSLYSRGSTLDDVATVVALAG 170 SVS R+T +++ S +DD T V + G Sbjct: 253 SVSSETNHNERSTPRSHAKPSLIDDEPTEVTIGG 286 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 271 SVSQYREQTGRATYSLYSRGSTLDDVATVVALAG 170 SVS R+T +++ S +DD T V + G Sbjct: 253 SVSSETNHNERSTPRSHAKPSLIDDEPTEVTIGG 286 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 318 LVLELTIFHSIFPIAGLFLNI 256 +V+ LTI + I + G+F NI Sbjct: 39 MVIPLTIIYMIIFVTGIFGNI 59 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 271 SVSQYREQTGRATYSLYSRGSTLDDVATVVALAG 170 SVS R+T +++ S +DD T V + G Sbjct: 253 SVSSETNHNERSTPRSHAKPSLIDDEPTEVTIGG 286 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 559 GITVPSSEQKQSGRTHCRNRMA 494 GIT+ ++E R RNRMA Sbjct: 1119 GITLRTAEVHNRSRETARNRMA 1140 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 412 DRVQCK*SRRKRGSHLDRVVLQCTREALFYAP 317 DRV + + R +DR L C R + + P Sbjct: 313 DRVLSELVSKMREMKMDRTELGCLRSIILFNP 344 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 412 DRVQCK*SRRKRGSHLDRVVLQCTREALFYAP 317 DRV + + R +DR L C R + + P Sbjct: 313 DRVLSELVSKMREMKMDRTELGCLRSIILFNP 344 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 320 SLFLSLQFFTASFQSQVCFSISRTN 246 SLF LQ +T SF Q +R+N Sbjct: 235 SLFCGLQKYTRSFAHQSINKEARSN 259 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 320 SLFLSLQFFTASFQSQVCFSISRTN 246 SLF LQ +T SF Q +R+N Sbjct: 230 SLFCGLQKYTRSFAHQSINKEARSN 254 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,466 Number of Sequences: 438 Number of extensions: 4776 Number of successful extensions: 25 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -