BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20541 (768 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70330.1 68414.m08091 equilibrative nucleoside transporter fa... 36 0.022 At3g10420.2 68416.m01250 sporulation protein-related similar to ... 31 0.85 At3g10420.1 68416.m01249 sporulation protein-related similar to ... 31 0.85 At3g09660.1 68416.m01145 minichromosome maintenance family prote... 30 2.0 At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:... 29 3.4 At5g51560.1 68418.m06393 leucine-rich repeat transmembrane prote... 29 4.5 At5g50070.1 68418.m06200 invertase/pectin methylesterase inhibit... 28 6.0 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 28 6.0 At2g02560.1 68415.m00195 TIP120 protein, putative similar to TBP... 28 6.0 At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-g... 28 6.0 At1g63670.1 68414.m07205 expressed protein 28 6.0 At5g12120.1 68418.m01423 ubiquitin-associated (UBA)/TS-N domain-... 28 7.9 >At1g70330.1 68414.m08091 equilibrative nucleoside transporter family protein contains similarity to SWISS-PROT:Q14542 equilibrative nucleoside transporter 2 (Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter, Equilibrative NBMPR-insensitive nucleoside transporter, Nucleoside transporter, ei-type, 36 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, Delayed-early response protein 12) [Homo sapiens] Length = 450 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/63 (25%), Positives = 31/63 (49%) Frame = -1 Query: 540 RSRSSQEGHTAGIAWRSSIWVVVNITRIFIRSIATVLFAVTEKTAFNASRVAASEEAILT 361 R +S ++G G+AWR+++W +V T++ VL + + F +LT Sbjct: 272 REKSEEKGSLTGLAWRTTLWDIV--TKVKSHGFGIVLLYMVTLSIFPGYITEDVHSELLT 329 Query: 360 EWF 352 +W+ Sbjct: 330 DWY 332 >At3g10420.2 68416.m01250 sporulation protein-related similar to hypothetical proteins: GB:P51281 [Chloroplast Porphyra purpurea], GB:BAA16982 [Synechocystis sp], GB:P49540 [Odontella sinensis], GB:AAB82669 [Chloroplast Cyanidium caldarium]; similar to stage III sporulation protein AA (GI:18145497) [Clostridium perfringens str. 13]; similar to stage III sporulation protein AA (mutants block sporulation after engulfment) (GI:22777578) [Oceanobacillus iheyensis] Length = 684 Score = 31.1 bits (67), Expect = 0.85 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = -2 Query: 710 DKISGLDIATVRVFALAVKYLFVQFNVVIVNRIIEGDSDHLRDISGG*VAGDHCAVLGAE 531 D SG+D + R+ A+ + L V V R++ G ++ +RD+ G G V+G+ Sbjct: 166 DNRSGIDRSLHRISAIRNRKLQVIGLTCRVGRVVSGSAEIIRDLIEG---GGSILVIGSP 222 Query: 530 AVRKDTL 510 V K TL Sbjct: 223 GVGKTTL 229 >At3g10420.1 68416.m01249 sporulation protein-related similar to hypothetical proteins: GB:P51281 [Chloroplast Porphyra purpurea], GB:BAA16982 [Synechocystis sp], GB:P49540 [Odontella sinensis], GB:AAB82669 [Chloroplast Cyanidium caldarium]; similar to stage III sporulation protein AA (GI:18145497) [Clostridium perfringens str. 13]; similar to stage III sporulation protein AA (mutants block sporulation after engulfment) (GI:22777578) [Oceanobacillus iheyensis] Length = 547 Score = 31.1 bits (67), Expect = 0.85 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = -2 Query: 710 DKISGLDIATVRVFALAVKYLFVQFNVVIVNRIIEGDSDHLRDISGG*VAGDHCAVLGAE 531 D SG+D + R+ A+ + L V V R++ G ++ +RD+ G G V+G+ Sbjct: 166 DNRSGIDRSLHRISAIRNRKLQVIGLTCRVGRVVSGSAEIIRDLIEG---GGSILVIGSP 222 Query: 530 AVRKDTL 510 V K TL Sbjct: 223 GVGKTTL 229 >At3g09660.1 68416.m01145 minichromosome maintenance family protein / MCM family protein similar to SP|P49717 DNA replication licensing factor MCM4 (CDC21 homolog) {Mus musculus}; contains Pfam profile PF00493: MCM2/3/5 family Length = 777 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 318 LVLELTIFHSIFPIAGLFLNIENKPAGQRIACIPEAVH 205 L L+L F I I F+N+E+ P G I C+ AVH Sbjct: 77 LSLDLQQFKKISDIENFFINLEDNPKGV-IPCMNAAVH 113 >At2g17820.1 68415.m02064 histidine kinase 1 99% identical to GP:4586626 Length = 1207 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 403 ERGLFCNGEKDCGDGSDENSCDIDNDPNRAPPCDS 507 +RGL CN ++ G+GSDE+ ++ DP + C S Sbjct: 935 KRGL-CNDLRNRGNGSDESHDCLEIDPTQFDTCSS 968 >At5g51560.1 68418.m06393 leucine-rich repeat transmembrane protein kinase, putative Length = 680 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 226 SYTLPGRFVLDIEKQTCDWKDAVKNCKLKNK--ERKIKP 336 S+++ G D E CDWK V N L+ K KI P Sbjct: 51 SWSVNGDLCKDFEGVGCDWKGRVSNISLQGKGLSGKISP 89 >At5g50070.1 68418.m06200 invertase/pectin methylesterase inhibitor family protein low similarity to pollen-specific protein Bnm1 [Brassica napus] GI:1857671; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 183 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 289 AVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDS 393 A K+ N K +P L T+ CQ+ F++ GDS Sbjct: 82 AKKSASFANGAAKKEPSLKTQFQTCQEAFVSIGDS 116 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 469 YHKNFHQIHRHSPFRRYRKDRVQC 398 YH + H HS RR KDR +C Sbjct: 245 YHSHRSSAHTHSSHRRRSKDREEC 268 >At2g02560.1 68415.m00195 TIP120 protein, putative similar to TBP-interacting protein TIP120 GI:1799570 from [Rattus norvegicus] Length = 1219 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 492 SAMRFLQCVLPDCFCSEDGTVIPG 563 S +R L VLPDC G+++PG Sbjct: 449 SVLRELVVVLPDCLADHIGSLVPG 472 >At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-glucan glucanohydrolase, putative similar to SP|P17859 Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) {Vigna mungo}, alpha-amylase [Malus x domestica] GI:7532799; contains Pfam profile PF00128: Alpha amylase, catalytic domain Length = 887 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +3 Query: 27 WPRASCSPARLLMVTDGGDKLTRRQRKMKAWNKNYARTRTPANGSGWWPARATT 188 W A+ A VT G T Q K + W + + + P GWWP+RA T Sbjct: 717 WINATSGAAGAFDVTTKGILHTALQ-KCEYWRLSDPKGKPPGV-VGWWPSRAVT 768 >At1g63670.1 68414.m07205 expressed protein Length = 689 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = +3 Query: 540 EDGTVIPGDLPARDVPQMITITFD----DAINNNNI-ELYKEIFNGKRKN 674 ED TVIPG++ ++ + I ++FD D I ++ E K++ R N Sbjct: 491 EDETVIPGNVKISNLEEKIGLSFDDPNIDLIEKESVHEFVKKVLEASRLN 540 >At5g12120.1 68418.m01423 ubiquitin-associated (UBA)/TS-N domain-containing protein contains Pfam profile PF00627: UBA/TS-N domain Length = 619 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 126 NYARTRTPANGSGWWPARATTVATSSSVLP 215 N + T A GSGW PA + A S+ LP Sbjct: 421 NASFTGAAAAGSGWHPANRSEAAQSNGYLP 450 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,342,767 Number of Sequences: 28952 Number of extensions: 359784 Number of successful extensions: 1171 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -