BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20540 (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 3.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 3.9 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.1 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 3.9 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 16 NSWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 138 N +VAR A F V IN+ + R+ L+ T+N Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 27 RRKTNISESICQRCFHQ 77 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 387 PFLVGAPICLVNSGNERD 440 PF+ PI ++NSG+ +D Sbjct: 314 PFIDRTPIEIINSGDVQD 331 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 387 PFLVGAPICLVNSGNERD 440 PF+ PI ++NSG+ +D Sbjct: 314 PFIDRTPIEIINSGDVQD 331 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,207 Number of Sequences: 438 Number of extensions: 2632 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -