BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20537 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 25 3.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 3.9 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 23 6.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 6.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.0 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 24.6 bits (51), Expect = 3.0 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 284 DHLMECCALP 255 DHLM+CCA P Sbjct: 48 DHLMQCCAEP 57 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.2 bits (50), Expect = 3.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 346 GREGFWMPYHTAVLVVKRSPQRNVP 420 GR+ PY+T +L+V+ S VP Sbjct: 791 GRDCEAAPYYTGILLVRHSQSDEVP 815 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 336 TINGQRGFLDAIPYCSSCGEE-KPAKKCSKCKSVQ 437 T N + + DA+ YCSS G K ++C+ +Q Sbjct: 54 TPNLRLNWFDAVSYCSSIGMSIATIKDTNECQLLQ 88 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/18 (33%), Positives = 9/18 (50%) Frame = +3 Query: 375 YCSSCGEEKPAKKCSKCK 428 +C CG + C +CK Sbjct: 366 HCIDCGANRDGPNCERCK 383 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 301 LLVKAVTI*WNVVHSLMGIPSRSL 230 L+ A+++ W VVHS+ GI + L Sbjct: 1983 LVGSALSVLWMVVHSVHGIMFKDL 2006 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,936 Number of Sequences: 2352 Number of extensions: 16471 Number of successful extensions: 65 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -