BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20531 (485 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39846| Best HMM Match : SIR2 (HMM E-Value=1.4013e-45) 104 4e-23 SB_39360| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 27 6.2 SB_33148| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-09) 27 8.2 >SB_39846| Best HMM Match : SIR2 (HMM E-Value=1.4013e-45) Length = 427 Score = 104 bits (249), Expect = 4e-23 Identities = 55/109 (50%), Positives = 72/109 (66%) Frame = +1 Query: 22 MADVEVEVPTNPILSGNNMDVNVALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLA 201 M+D E + T +G MD+N ALQEVLKTALIH GL GLHEAAK+LDKR+A LC+L+ Sbjct: 1 MSDAEGDDTTQQPAAGGAMDINTALQEVLKTALIHDGLSRGLHEAAKSLDKREAHLCILS 60 Query: 202 ENCDEAAYKKLVQALCNDIRFHWSRLTTTKSLENGLVSARLTRMARQGK 348 NCDEA Y KLV+ALC + ++ +K L A L ++ ++GK Sbjct: 61 NNCDEAMYVKLVEALCAEHGIPLLKVDDSKKLGEW---AGLCKIDKEGK 106 Score = 83.0 bits (196), Expect = 1e-16 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +3 Query: 255 HQIPLVKVDNNKKLGEWAGLCKIDKDGKARKIVGCSCVVIK 377 H IPL+KVD++KKLGEWAGLCKIDK+GKARK+VGCSCVV+K Sbjct: 79 HGIPLLKVDDSKKLGEWAGLCKIDKEGKARKVVGCSCVVVK 119 >SB_39360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 374 DDNTGAADNFPCLAILVNLAETSPFSKLF 288 DD +D +PC+ I+VN++ T +K F Sbjct: 10 DDGLTCSDVYPCVEIMVNISSTGSETKKF 38 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 398 SVGCAQGLPQVVELILRCNANPY 466 S+ CA G VVEL+L ANPY Sbjct: 83 SLACAGGHLAVVELLLAHGANPY 105 >SB_33148| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-09) Length = 330 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 97 QEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLV 237 + +L+ +G ++ L A + R LCV A CDE ++ LV Sbjct: 70 KSLLQQPCPNGRVILSLAVADLCIGLRLEALCVFAARCDEMTWRVLV 116 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,763,026 Number of Sequences: 59808 Number of extensions: 315179 Number of successful extensions: 859 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -